Ma `lumot

Protein ikkilamchi tuzilmalarida spirallarning har xil turlari qanday va ular qanday farqlanadi?

Protein ikkilamchi tuzilmalarida spirallarning har xil turlari qanday va ular qanday farqlanadi?



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Protein ikkilamchi tuzilmalarida spirallarning har xil turlari qanday va ular qanday farqlanadi?

DSSP hujjatlarida spirallarning turlari qayd etilgan: Alpha-Helix, Helix-3 va Helix-5.

STRIDE hujjatlarida keltirilgan spiral turlari: Alpha-Helix, 3-10 Helix, PI-Helix.

Nima uchun DSSP-da Helix-3 va Helix-5 mavjud, STRIDE-da esa 3-10 Helix va PI-Helix mavjud - ular bir xil narsa uchun turli iboralarmi?

Ushbu turdagi spirallarning qanday farqlari bor, ular haqida ko'proq o'qishim uchun ularning to'liq ilmiy nomlari qanday va bu erda aytilmagan boshqa spiral turlari bormi?


Ushbu DSSP sahifasi quyidagilarni aniq ko'rsatadi:

Helix-3 = 3-10 spiral

Spiral-5 = p-spiral

The a-spiral har bir biokimyo darsligida va Internetda keng tasvirlangan. U har bir spiral burilishda 3,6 qoldiqga ega va vodorod aloqasi natijasida hosil bo'lgan halqada 13 atomga ega va shuning uchun 3,6-13 spiral deb ham atash mumkin.

The 3-10 spiral a-spiralga qaraganda kamroq tarqalgan, lekin hali ham keng tarqalgan. Hozirgina a-spiral uchun tavsiflangan muqobil nomenklaturaga o'xshab, u 10 atomli halqada har bir burilishda 3 ta qoldiqga ega.

The p-spiral hatto kamroq tarqalgan. Bu har bir burilishda 4,6 qoldiq bo'lgan kengroq spiraldir.

Uchalasini taqqoslashni men quyidagi rasmni olgan ushbu proteopediya maqolasida topish mumkin.

Shuningdek, mavjud kollagen uch spiral, lekin bu kollagenga xosdir, boshqalari esa ko'plab oqsillarda mavjud bo'lgan ikkilamchi tuzilishga umumiy misollardir.

Standart nomenklatura

Molekulyar biologiyaning ushbu sohasida "to'liq ilmiy ism" degan narsa yo'q. Noaniqlik muammoga aylanganda, nomlar norasmiy kelishuv asosida standartlashtiriladi. a-spiraldan boshqa spirallar unchalik yaxshi ma'lum emas, lekin 3-10 spiral va p-spiral atamalari, albatta, Helix-3 va Helix-5 ga qaraganda keng tarqalgan bo'lib, men hisoblashda qulaylik bo'lgan deb o'ylayman. Biroq, internet qidiruvi ilmiy jurnallar uchun ekanligini ko'rsatadi 310- spiral odatda 3-10 spiral yoki 3(10) spiraldan afzalroqdir, bu ikkinchisi, ehtimol, oddiy matn muhitidagi ishni yoki yozuvchilarning so'zni qayta ishlash yoki HTML cheklovlarini aks ettiradi.


Vintning burilishi: oqsilning ikkilamchi tuzilishidagi mashq

Protein spiral va varaqning ikkilamchi tuzilmalarini ko'rsatish uchun oddiy qog'oz chiziqlar yordamida mashq taqdim etiladi. Dastlabki amaliyotchilar, xususan Linus Pauling tomonidan oqsil biokimyosida fizik modellardan foydalanishning boy tarixiy kontekstiga tayangan holda, ushbu faoliyatning maqsadi talabalarda oqsilning ikkilamchi tuzilishining amaliy, intuitiv tuyg'usini rivojlantirish va umumiy tushunchalarni to'ldirishdir. biokimyoni o'qitishda tez-tez ishlatiladigan kompyuterga asoslangan strukturaviy tasvirlar. Talabalar ushbu qog'oz chiziqlarni model ikkilamchi tuzilmalarga katlar ekan, ular polipeptidning ikkilamchi tuzilishga katlanishida molekula ichidagi vodorod bog'lanishlari qanday hosil bo'lishini va bu vodorod aloqalari spiral va varaq strukturalarining umumiy shaklini, shu jumladan qo'lning qo'lligini qanday yo'naltirishini yaxshiroq tushunadilar. a-spiral va o'ng va chap qo'lning burilish o'rtasidagi farq. BIOKIMYO VA MOLEKULAR BIOLOGIYA TA'LIM JIL. 39, № 3, 221–225-betlar, 2011 yil.

Biokimyoning quvonchlaridan biri - bu oddiy shakllarning qayta-qayta takrorlanishi, o'sishi va hayotning murakkabligiga aylanishi. Jmol [1] kabi texnologiyalar va boshqa tuzilmalarni tomoshabinlar makromolekulyar tuzilmalarning interfaol tasvirlariga deyarli bir zumda kirish imkonini beradi, chunki foydalanuvchining grafik kartasi va tarmoqli kengligi qoʻllab-quvvatlay oladigan darajada yuqori aniqlikdagi, yuqori aniqlikdagi, kattalashtirish va aylantirish mumkin boʻlgan shon-shuhratda. . Bakalavrning noutbukiga o'yinga o'xshash videoni olib kelish qobiliyati oqsil va nuklein kislota tuzilmalarini o'rganish uchun qiziqarli ilgakdir.

Biroq, Jmol va uning Chime va Rasmol kabi ajdodlaridan oldin, molekulyar tuzilmani tomoshabinlar diqqat bilan yaratilgan jismoniy modellardan iborat edi. Kristallograflarning ishi kattaroq va kattaroq makromolekulaga o'tganligi sababli, strukturaviy biologiyaning rivojlanayotgan sohasida ishlaganlar o'zlarining molekulyar mavzularini uch o'lchovda tasavvur qilishning qandaydir usullariga muhtoj edilar. Ularning eng istiqbollilari, Jon Kendry va Maks Perutz, Linus Pauling va Robert Kori, Jeyms Uotson va Frensis Krik kabi juftliklar yog'och va metallning tayoq yoki to'p va tayoq modellariga murojaat qilishdi. Ehtimol, eng mashhuri Uotson va Krikning fotosuratida saqlangan, ularning ikki tomonlama spiral modeliga qaragan suratdir - Google-da Uotson va Krikning rasmlarini qidirish uni tortib oladi. 1950-yillardagi yog'och sharlar va metall vintlardan tortib, zamonaviy plastiklarga qadar (rangliroq va qulayroq moslashuvchan) molekulyar modellar sensorli, vizual va fazoviy intuitsiyani chinakam amaliy tarzda jalb qiladi, bu esa kompyuter sichqonchasining o'ziga xosligi bo'lib qoladi. protein va nuklein kislota tuzilmalarini tom ma'noda tushunishning estetik va funktsional usuli.

Proteinning ikkilamchi tuzilishini o'rgatishda men ko'pincha talabalarga "Darling" molekulyar modellari (bizning organik kimyo kursimizda qo'llaniladi, shuning uchun mening biokimyo darslarimga yaxshi tanish) yordamida namunaviy aminokislotalarni tayyorlaydilar va keyin ularni amid bog'lari orqali polipeptidlarga birlashtiradilar, ularni katlaydilar. a-spiral va b-plifli varaq konstruksiyalariga. Biroq, bog'lanishning ko'plab aylanishi mumkin va berilgan P va P bog'lanish burchaklari to'plami o'rtasidagi bog'liqlik har doim ham darhol bo'lavermaydi. Protein tuzilishini ko'rish uchun origami uslubidagi qog'ozni buklash ham kompyuter modellashtirish, ham molekulyar modellarga nisbatan o'rgatuvchi va qulay (va arzon). Shuningdek, u oqsil tuzilmalarini kashf qilishda tarixiy pretsedentga ega. 1948 yilda Linus Pauling Cal Techda fizik kimyo bo'yicha karerasini yo'lga qo'ygandan so'ng, o'z e'tiborini biologik molekulalarga qaratdi va bir yilni Angliyaning Oksford shahrida tashrif buyuruvchi professor sifatida o'tkazdi. Angliyadagi kaliforniyalik odam shunday qilishi kutilgandek, u qattiq shamollab, bir necha kun yotoqda yotib qolganga o'xshaydi. Pauling sog'ayish paytida zerikib, amid vodorodi o'rtasidagi to'liq vodorod bog'lanishini hisobga olish uchun bir xil tuzilgan individual aminokislotalarni bog'laydigan planar trans-amid bog'lanish faraziga asoslangan polipeptid tuzilmalari haqida o'ylay boshlaganini va eskizini chiza boshlaganini aytdi. va kislorod atomlari [2]. Polingning Oregon shtat universitetida saqlanayotgan qog'ozlari uning eskizlaridan birining nusxasini o'z ichiga oladi, unda qog'ozni har bir amid vodorod atomini aminokislotalarning amid kislorod atomi bilan vodorod bog'lash yo'nalishlari bilan to'rtta qoldiq, biz hozir shunday deb ataymiz. a-spiral [3].

Men Pauling sketchining nusxalarini oqsil katlamasiga kirish sifatida sinf mashqi sifatida ishlatmoqchi bo'ldim, lekin eskiz har safar va oxir-oqibat juda xafa bo'lib, chap qo'l spiral hosil qilishini aniqladim. Chap qo'lli spiral - bu an'anaviy "o'ngga mahkamlangan" vintga qarama-qarshi bo'lgan vint. Buklangan Pauling eskizini har qanday biokimyo darsligidagi a-spiral oqsilining rasmi bilan taqqoslash, Paulingning eskizi an'anaviy oqsil spiralining oyna tasviri ekanligini tasdiqlaydi.

Poling buni noto'g'ri tushunganmi? Aftidan, u shunday qilganga o'xshaydi - Oregon shtat universitetida saqlangan eskiz o'sha paytdagi Paulingning fikrlashiga nisbatan anormal tarzda aylantirilmagan, lekin uning spiralni tasvirlash uslubiga mos keladi. Paulingning kasal to'shagidan ilhomlanishi u Robert Kori bilan kristallografik ma'lumotlarga asoslangan oqsil tuzilishi bo'yicha davom etgan hamkorlikning bir qismi edi. Ularning ishi Milliy Fanlar Akademiyasi (PNAS) jurnalining 1951-yil 15-maydagi sonida ketma-ket yettita maqoladan iborat boʻlgan maqolalarda yorugʻlikni koʻrdi. Maqolalar seriyasi va ularning tarixi va kontekstining qisqacha mazmuni PNAS [4] tomonidan onlayn nashr etilgan. Birinchi maqola [5] a-spiraldan kutilayotgan kristallografik parametrlarni (ular buni 3,7-qoldiq spiral deb atashgan) hamda p-spiraldan (keyinchalik 5,1-qoldiq spiral deb atalgan) tasvirlaydi, lekin chap tomon o‘rtasida hech qanday farq qilmaydi. - va har birining o'ng qo'li versiyalari. Ikkinchi maqola [6] bir nechta sintetik gomopolimerik polipeptidlarning tuzilmalarini kristallografik birlik hujayra simmetriyasiga va a-spiralni qo'llab-quvvatlaydigan takror uzunligiga asoslangan xulosalar bilan taqdim etadi, lekin spiralning qo'llanish qobiliyati haqida hech qanday izoh berilmaydi. Aslida, p- va a-spirallar ularning chap qo'l versiyalarida tasvirlangan.

Uchinchi qog'oz [7] ipak oqsilidan b-pleated choyshab tuzilishini taqdim etadi, bu erda qo'lni ushlab turish muammo emas. To'rtinchi va beshinchi qog'ozlar [8, 9] keratinlarga qaratilgan bo'lib, ular tabiatda a-spiral deb to'g'ri chiqarilgan va bu spirallarning har bir tasviri chap qo'ldir. Oltinchi [10] kollagenning o'ralgan-o'ralgan uch spiralini taqdim etadi, u aslida chap qo'ldir va PNAS qog'ozida shunday tasvirlangan. Ettinchi maqola [11] gemoglobinning tuzilishi bilan bog'liq bo'lib, yuqori darajada b-spiral tarkibga ega ekanligi to'g'risida to'g'ri bahs yuritadi, lekin qo'l ishi bo'yicha qat'iy emas.

Poling va Kori spiral ma'noning imkoniyatlarini ko'rib chiqishdi. PNASda chop etilgan maqolada, yetti qatorli asardan bir necha oy oldin, ikkalasi Xarvi Branson bilan birgalikda faqat geometriyaga asoslangan a/3,7 spiral va p/5,1 spiralning tafsilotlarini nashr etishgan. peptid bog'i, a-spiralni chap qo'l bilan burilish bilan va p-spiralni o'ng qo'l bilan ko'rsatadi. Ushbu qog'ozning ikkinchi va uchinchi raqamlarida ular chap va o'ng velosiped pedallari kabi bir-biridan ajralib turadi, ammo farq haqida hech qanday izoh berilmagan. Poling va Korining a-spiral tasvirlaridagi spiral noaniqligi 1951 yildan beri ko'p izoh keltirmaganga o'xshaydi, aslida men Jek Dunitzning Angewante Chemiedagi [12] inshosida bu haqda sharhlovchi faqat bitta nashrni topdim. Dunitz Pauling, Kori va Bransonning aprel oyidagi PNAS qog'ozida ko'rsatilgan a-spiralning chap qo'lda aylanishini ta'kidlaydi va taqdim etilgan spirallarning burilishlari, shuningdek, aminokislotalarning mutlaq stereokimyosi o'zboshimchalik bilan tayinlanganligini ta'kidlaydi. . 1951 yilda mutlaq stereokimyoni aniq belgilash qobiliyati sahnada paydo bo'ldi. Bu vaqtgacha stereokimyoga faqat nisbiy asosda kirish mumkin edi. Fisher qoidalari D va L uglevodlarini (va kengaytmasi bilan aminokislotalarni) ajratib ko'rsatdi, ammo qaysi enantiomer, aytaylik, glyukoza yoki alanin, bugungi organik kimyo talabasi R/S Kan-Ingold-Prelog konventsiyasi sifatida nimani o'rganadi. aniqlash mumkin emas edi. Dunitsning ta'kidlashicha, taxminan 1950 yilda kimyogarlar mutlaq stereokimyoni aniqlash uchun kristallografiyadan qanday foydalanishni aniqladilar, ammo bu o'sha paytda eng muhim yangilik edi. U shunday xulosaga keladi: "Yoki Pauling a-spirali qog'ozni yozganida bu voqealardan bexabar edi yoki u ular haqida bilar edi, lekin unga qiziqmadi".

Paulingning tug'ma intellektual qiziquvchanligini hisobga olsak, u spiral burilish masalasi haqida o'ylamaganiga ishonish qiyin ko'rinadi va men u va Kori shunchaki pul tikishayotganiga shubha qilaman. Bu, ehtimol, oqilona edi, chunki 10 yildan ko'proq vaqt o'tgach, Ramachandran tomonidan aminokislotalar bilan bog'lanish burchaklarining sinchkovlik bilan tahlili individual aminokislotalarning P va P burchaklarining mahalliy konformatsiyasi qanday qilib o'ng qo'lni chap qo'lni afzal ko'rishiga olib kelishini ko'rsatdi. uzatilgan polipeptid spirallari farq juda nozik.

Ushbu maqoladagi dastlabki maqsadim shunchaki foydali deb topilgan oqsillarni yig'ish bo'yicha mashqni baham ko'rish edi, ammo bu erda stereokimyo talabalarga bakalavriat biokimyosi uchun foydali sayohatdir. Oqsil va nuklein kislota strukturalarining oʻzaro taʼsirining zamonaviy vositalarini oʻquvchilar qoʻliga (yoki kompyuterlariga) qoʻyish ham hayajonli, ham samarali boʻlsa-da, barcha rang-barang shon-shuhratda tuzilmalardan orqaga chekinish va ular faqat ijodkorlik tufayli mavjudligini yodda tutish foydalidir. va ko'plab olimlarning yillar davomida mashaqqatli mehnati. Shuningdek, 1951 yilda bo'lgani kabi, bizning molekulalarning tasvirlari talqin qilinganligi - to'liq emas va har doim qayta ko'rib chiqilishi kerakligi haqida yaxshi eslatma.

Bu erda taqdim etilgan qog'oz modellari polipeptid zanjiridagi bir xil konfiguratsiya qilingan aminokislotalar qoldiqlari amid vodorod va kislorod atomlarining peptid-peptid vodorod aloqalarini hosil qilishiga imkon beradigan tarzda spiral yoki planar tuzilmalarga to'planishi usullarini o'rganishga yordam beradi. . Ushbu tadqiqot an'anaviy ma'ruza kursiga yoki noan'anaviy kurs formatining bir qismi sifatida joylashtirilishi mumkin bo'lgan faol o'rganish tajribasini taqdim etadi. U individual yoki kooperativ/hamkorlik muhitiga moslashishda moslashuvchan. Bu organik kimyo bo'yicha asosiy bilimlarni, shu jumladan amid funktsional guruhi va stereokimyo bilan tanishishni o'z ichiga oladi, chunki odatdagi bakalavriat organik kursida o'rganiladi.


20 ta aminokislotalarning turlari va ularning tuzilishi

Barcha 20 ta aminokislotalarning har biri bir xil asosiy fundamental tuzilmadan iborat alfa (a) uglerod sifatida ham tanilgan markaziy uglerod atomi, bog'langan amino guruhi (-NH2), karboksil guruhi (-COOH), va vodorod atomiga.

Har bir aminokislota markaziy atomga bog'langan boshqa atom yoki atomlar guruhiga ega R guruhi .

Eukariotlarda hujayra sitoplazmasida erigan 21 ta proteinogen aminokislotalarning (standart genetik kodning 20 tasi, plyus selenotsistein) bir nechta nusxalari mavjud va bu aminokislotalar hujayra tomonidan oddiy birikmalardan hosil bo'ladi yoki oziq-ovqatdan olinadi.

Inson tanasi uchun muhim aminokislotalar

Lar bor 9 ta muhim aminokislotalar inson tanasi tomonidan ishlab chiqarilmaydigan va ratsiondan olinishi kerak.

Ushbu 9 ta muhim aminokislotalar ro'yxatiga quyidagi aminokislotalar kiradi:

  1. Triptofan
  2. Metionin
  3. Valin
  4. Treonin
  5. Fenilalanin
  6. Leysin
  7. Izoleysin
  8. Lizin
  9. Histidin

20 ta aminokislotalarning har xil turlari

Yon zanjirning kimyoviy tabiati aminokislotalarning tabiatini belgilaydi (ya'ni, kislotali, asosli, qutbli yoki qutbsiz).

20 ta aminokislotalarni quyidagi guruhlarga bo'lish mumkin:

  • Alifatik aminokislotalar: alanin, glitsin, izolösin, leysin, prolin va valin.
  • Aromatik aminokislotalar: fenilalanin, triptofan va tirozin
  • Kislotali aminokislotalar: aspartik kislota va glutamik kislota.
  • Asosiy aminokislotalar: arginin, histidin va lizin.
  • Gidroksilik aminokislotalar: serin va treonin.
  • Oltingugurt o'z ichiga olgan aminokislotalar: sitozin va metionin.
  • Amidik aminokislotalar: asparaginlar va glutamin.

Biokimyo savollari sayti

Yuqorida aytib o'tilganidek, oqsillarda to'rt xil tashkiliy darajani ajratishimiz mumkin:

The ikkinchi darajali tuzilma yoki ikkinchi darajali tashkilot polipeptid yoki oqsilning mahalliy hududida mavjud bo'lgan, peptid bog'i elementlari orasidagi vodorod bog'lari orqali barqarorlashgan konformatsiya sifatida aniqlangan.

Tashkil etilgan ikkilamchi tuzilmalar turli peptid guruhlari o'rtasidagi vodorod bog'lanishi bilan ta'minlanadi, ya'ni bir peptid bog'ining N-H guruhi va boshqa peptid bog'ining C = O guruhi o'rtasida.

Pauling va Kori oqsillarning mumkin bo'lgan ikkilamchi tuzilmalarini o'rganayotganda, ushbu darajadagi tashkilotning bir qismini tashkil etuvchi asosiy tuzilmalar quyidagi xususiyatlarga ega bo'lishi kerakligini ta'rifladilar (Poling va Kori postulatlari):

• Barcha aminokislotalar sterik L seriyasiga tegishli

• Peptid guruhi planar va trans konfiguratsiyada

• Har bir karbonil kislorod va amid azot vodorod bog'lanishida ishtirok etadi

• Molekulaning faqat alfa-uglerod atomlari atrofida aylanishi

• Vodorod bilan bog‘langan vodorodlar bog‘ hosil bo‘lishida ishtirok etuvchi kislorod va azot atomlarini tutashtiruvchi chiziqqa yaqin joylashgan.

• Aminokislotalarning R yon zanjiri tuzilishda ishtirok etmaydi

Ushbu ikkinchi darajali tashkilotda ko'rib chiqiladigan tuzilmalar o'z ichiga oladi :

Beta-burilishlar (aka Beta-burilishlar, aka soch turmagi egilishlari)

Takrorlanmaydigan ikkilamchi tuzilish

Alfa spiral

Bu oqsil tuzilishining ikkinchi darajali darajasi bo'lib, unda polipeptid magistral spiral tuzilish sifatida xayoliy o'q atrofida mahkam o'ralgan. (Peptid zanjirining helikoidal joylashuvi)

Ushbu klipda Linus Pauling alfa-spiralni qanday kashf etganini tasvirlaydi:

Alfa-spiralning strukturaviy xususiyatlari :

Spiralning har bir burilishida 3,6 ta aminokislotalar mavjud.

– Har bir peptid aloqasi trans va planardir

– Barcha peptid bog'lanishlarining N-H guruhlari bir xil yo'nalishga ishora qiladi, bu spiral o'qiga taxminan parallel.

– C=Barcha peptid bog'lanishlarining O guruhlari qarama-qarshi yo'nalishda, shuningdek, spiral o'qiga parallel.

– Har bir peptid bog'ining C=O guruhi peptid bog'ining N-H guruhiga vodorod bilan bog'langan bo'lib, undan to'rt aminokislota birlik uzoqlikda joylashgan.

– Barcha R-guruhlari spiraldan tashqariga ishora qiladi

Alfa-spiral barqarorligiga turli omillar ta'sir qiladi, ular orasida:

1. R zaryadlangan guruhlar bilan ketma-ket aminokislotalar orasidagi – elektrostatik o'zaro ta'sir.

2. – qo'shni R guruhlarning kattaligi

3. – R guruhlari o'rtasidagi o'zaro ta'sirlar 3 yoki 4 qoldiqni bir-biridan ajratib turadi.

Polipeptidlardagi barcha aminokislotalar qoldiqlarining taxminan 1/4 qismi alfa-spirallarda joylashgan bo'lib, aniq ulush bir oqsildan ikkinchisiga juda katta farq qiladi.

Ushbu misolda kalmoludindagi alfa spiral tuzilmalariga e'tibor bering:

Beta qatlamli varaq

Bu ikkilamchi tuzilma oqsillarni tashkil qilishning ikkilamchi darajasi sifatida belgilangan, bunda peptid zanjirining (Beta-iplar) orqa suyagi zigzag shakliga cho'zilgan, peptid bog'lari o'zgaruvchan qiyaliklar (almashinuvchi) tekisliklarida tashkil etilgan burmalar qatoriga o'xshaydi. ko'tarilish va pasayish yo'nalishi). Beta qatlamli varaq ikkita peptid zanjiri yoki bir xil peptid zanjirining turli segmentlari o'rtasida hosil bo'lishi mumkin.

Beta qatlamli varaqning xususiyatlariga quyidagilar kiradi

1. – Har bir peptid bog'i planar va trans konformatsiyasiga ega

2.- C=O va N-H peptid bog'lanishlarining qo'shni zanjirlar guruhlari bir-biriga qaratilgan va ular o'rtasida vodorod bog'lanishi mumkin bo'lishi uchun bir xil tekislikda joylashgan.

3.- Har qanday zanjirdagi barcha R-guruhlar bir-birini almashtirib turadi, avval yuqorida, keyin varaq tekisligi ostida va hokazo.

Ikki xil beta qatlamli choyshablar mavjud:

Antiparallel: qo'shni polipeptid zanjirlari qarama-qarshi yo'nalishda harakat qilganda

Parallel: bir xil yo'nalishda ishlaydigan qo'shni polipeptid zanjirlari

Odatda beta konformatsiyasini ko'rsatadigan polipeptidlar segmenti alohida-alohida beta-iplar deb ataladi va ular ip o'tadigan yo'nalishni (aminodan karboksil guruhiga) ko'rsatadigan o'q bilan ifodalanadi.

Ikkala model ham oqsillarda uchraydi, ammo antiparallel struktura parallel beta-varaqqa qaraganda barqarorroq.

Oqsillardagi beta konformatsiyasining tarkibi juda o'zgaruvchan: masalan, miyoglobin bunday ikkilamchi tuzilishni ko'rsatmaydi, ximotripsindagi aminokislotalarning 45 foizi beta konformatsiyasining bir qismidir.

Shuni ta'kidlash kerakki, barcha polipeptid zanjirlari alfa-spiral yoki beta konformatsiyasining bir qismi emas. Bundan tashqari, egilishlar, tartibsiz o'ralgan yoki kengaytirilgan cho'zilgan segmentlar mavjud: masalan, karboksipeptidaza alfa-spiralni tashkil etuvchi aminokislotalarning 38% va beta tuzilmalarini hosil qiluvchi 27% ni ko'rsatadi, shuning uchun qoldiqlarning taxminan 35% bu ikkilamchi tuzilmalarga kirmaydi. .

Bu peptid zanjirining yo'nalishini o'zgartirishga imkon beradigan oqsilni tashkil qilishning ikkinchi darajasi.

Ular teskari burilishlar, soch turmagi burmalari yoki Omega-looplar kabi ma'lum bo'lib, ular ko'pincha 5 yoki undan kam aminokislota qoldiqlarida uchraydi va ular gidrofil bo'lganligi sababli oqsil yuzasida yotadi. Beta-burilish halqalari oqsillarni siqish imkonini beradi, chunki hidrofobik aminokislotalar odatda oqsilning ichki qismida bo'ladi, hidrofil qoldiqlari esa suvli muhit bilan o'zaro ta'sir qiladi.

Quyidagi rasmda alfa-spiral tuzilmalari va beta-konformatsiyalar (o'qlar bilan ko'rsatilgan beta iplar) bu oqsilni ixcham holga keltiradigan egilishlar va beta burilishlar orqali qanday bog'langanligini ko'ring.

Turli xil aminokislotalar har xil turdagi ikkilamchi tuzilmalarni qo'llab-quvvatlaydi: alanin, glutamat va leytsin a spirallarda bo'lishga moyil bo'lsa, valin va izolösin beta iplarni, glitsin, asparagin va prolin esa beta-burilishlarda mavjud.

Agar siz ikkilamchi tuzilma haqida ko'proq ma'lumot olishni istasangiz, bu boshlash uchun juda qiziqarli maqola bo'ladi:

a-spiral va b-varaqning kashf etilishi, oqsillarning asosiy tuzilish xususiyatlari.


Oqsillardagi elektrostatik o'zaro ta'sirning rollari

Linderstrom-Lang va Kirkvud o'zlarining faraziy "oqsil" tuzilmalarini tahlil qilgandan keyin 60 yildan ko'proq vaqt o'tgach, bizda ko'plab eksperimental dalillar va oqsillardagi elektrostatik kuchlarning hisoblash baholari mavjud, ular atom ruxsatida juda ko'p protein 3D tuzilmalariga ega. Ayni paytda, elektrostatikaning roli haqida, asosan, empirik topilmalar va tendentsiyalardan kelib chiqqan holda, boshida ko'plab dalillar va takliflar mavjud edi. Bir nechta eksperimental natijalar shuni ko'rsatdiki, elektrostatik hissa bir necha kkal / mol darajasida bo'lib, uni to'g'ri ko'paytirish nazariy jihatdan qiyin edi, chunki katta qarama-qarshi reaktsiya maydonini katta, to'g'ridan-to'g'ri Kulomb maydonidan olib tashlash kerak. Reaktsiya maydonining ahamiyati hatto 70 yil oldin tan olingan bo'lsa-da, oqsil molekulalariga tegishli ilovalar faqat shu o'n yillikda raqamli hisoblashning rivojlanishi bilan amalga oshirildi. Hozirgi vaqtda elektrostatik molekulyar sirt strukturaviy biologiya jurnallarida eng mashhur rasmlardan biri bo'lib, elektrostatik kuch hozirgi biologiya va biokimyoning asosiy yo'nalishi bo'lgan molekulyar tan olinishiga hissa qo'shadigan muhim tarkibiy qismlardan biri ekanligini ko'rsatadi. NMR texnikasining rivojlanishi 3D strukturasini aniqlashdan tashqari, oqsildagi ionlanadigan guruhlarning individual ionlanishini kuzatish imkonini berdi. Hech qanday qo'shimcha tekshiruvni talab qilmagani uchun, har bir zaryad holati dastlabki maydonni buzmasdan, oqsilda ishlaydigan juda mahalliy va heterojen elektrostatik potentsiallar haqida xabar berishi mumkin. pKa qiymatlaridan elektrostatik o'zaro ta'sirlar, ion juftlari, zaryad-dipol o'zaro ta'sirlari va vodorod aloqalarining oqsil barqarorligiga qo'shgan hissasi to'g'ri baholandi. Protein muhandisligi, shuningdek, mahalliy oqsillardan olinadigandan ko'ra ko'proq ma'lumot beradi, chunki tegishli qoldiqlar endi elektrostatik jihatdan farq qiluvchi xususiyatlarga ega bo'lgan boshqa aminokislotalar qoldiqlari bilan osongina almashtirilishi mumkin. Ushbu eksperimental natijalar ilgari kutilganidan kamroq hissa qo'shdi, ehtimol biz reaktsiya maydonining ta'sirini kam baholaganimiz uchun. Ayniqsa, bitta ion juftligi oqsilni ozgina barqarorlashtiradi, garchi kooperativ tuz-ko'prik tarmog'i oqsil barqarorligiga sezilarli hissa qo'shishi mumkin. Oqsillarning marginal barqarorligi harakatlantiruvchi va qarama-qarshi kuchlar bilan ko'p omillar o'rtasidagi kichik farqdan kelib chiqadi. Har bir elektrostatik o'zaro ta'sirning oqsil barqarorligiga kichik hissasi bo'lishiga qaramay, ularning harakatlarining yig'indisi oqsilning o'ziga xos 3D tuzilishini saqlab qolish uchun ishlaydi. Protein konformatsiyasini beqarorlashtirishi mumkin bo'lgan elektrostatikaning "salbiy" rollarini ta'kidlash kerak. Bog'lanmagan ko'milgan zaryadlar hidrofobik yadrodan chiqish uchun energiya jihatidan juda qimmat. Izolyatsiya qilingan vodorod bog'lovchi donorlari va qabul qiluvchilar ham salbiy ta'sir ko'rsatadi, lekin ular bir necha kkal/mol xarajati bilan birlashtirilmagan ko'milgan zaryadlar kabi qimmat emas. Shu sababli, oqsil 3D tuzilmalarining statistik tahlillari izolyatsiya qilingan vodorod bog'lanish donorlari va qabul qiluvchilarining kamdan-kam holatlarini ko'rsatadi. Bu alfa-spirallar va beta-varaqlar faqat oqsil yadrolarida magistral tuzilmalar sifatida kuzatilishining asosiy sababi bo'lishi kerak. Bunday ikkilamchi tuzilmalar vodorod donorlari yoki akseptorlarini doimiy ravishda o'rashlari tufayli hech qanday magistral vodorod donorlarini yoki qabul qiluvchilarini juftsiz qoldirmaydi. Aks holda, barcha magistral amid va karbonil guruhlari oqsil yadrosida o'zlarining vodorod bog'lanish sheriklariga ega bo'lgan orqa miya tuzilishini qurish juda qiyin bo'lishi mumkin. Protein elektrostatikasiga ikkita nazariy yondashuv mavjud: makroskopik yoki kontinuum modeli va mikroskopik yoki molekulyar model. Ushbu maqolada ta'riflanganidek, makroskopik model o'ziga xos muammolarga ega, chunki protein-erituvchi tizim jismoniy nuqtai nazardan juda hetergendir.


Protein tuzilishi

Protein tuzilishining to'rt xil darajasi mavjud.

Birlamchi tuzilish oqsildagi turli aminokislotalarning ketma-ketligidir.

Ikkilamchi tuzilma deganda juda muntazam mahalliy quyi tuzilmalar nazarda tutiladi. Ikkilamchi strukturaning ikkita asosiy turi, alfa spiral va beta zanjir.

Uchinchi darajali struktura - oqsil molekulasining uch o'lchovli strukturasi.

To'rtlamchi struktura bir nechta oqsil molekulalarining kattaroq birikmasidir.

1. Asosiy tuzilma:

Proteinlar polimer hosil qilish uchun kovalent bog'langan aminokislotalardan tashkil topgan yirik molekulalardir:

The asosiy tuzilmaaminokislotalar zanjirining chiziqli ketma-ketligini bildiradi. Birlamchi struktura kovalent bog'lar (peptid bog'lari) bilan birga tutiladi.

Qanday funktsional guruh hosil bo'ladi (peptid bog'i)?

Yon mahsulot nimadan hosil bo'ladi?

Asosiy orqa miya (qutbli yoki qutbsiz)? Birini aylana.

Birlamchi oqsil tuzilishi a ga misol bo'la oladi [polimer yoki supramolekulyar birikma] ? Birini aylana.

2a. Ikkilamchi tuzilmalar &ndash Beta varaqlar

Proteinlar bir yoki bir nechta o'ziga xos fazoviy konformatsiyalarga &ndash burmalanadi ikkilamchi tuzilma. XVF ikkilamchi tuzilmalarni magistral funktsional guruhlar o'rtasida ushlab turadi.

Beta varaqlari quyidagilardan iborat beta zanjirlari(quyida ko'rsatilgan) XVF tomonidan lateral tarzda bog'langan, odatda buralgan, katlangan varaqni hosil qiladi.

XVJ bu ikki yo'nalishni nimada ushlab turibdi?

Yuqoridagi rasmda ushbu XVFda qaysi atomlar ishtirok etishini aniq ko'rsating.

Beta varaqlari parallel (bir yo'nalishda ishlaydigan ikkita ip) yoki antiparallel (qarama-qarshi yo'nalishda) bo'lishi mumkin.

Quyidagi rasmlardan qaysi biri parallel va qaysi biri antiparallel ekanligini aniqlang.

2b. Ikkilamchi tuzilmalar: Alpha Helices

The alfa spiral (&alfa spiral)oqsillarning ikkilamchi tuzilishiga yana bir misoldir.

Alfa spiral spiral konformatsiya bo'lib, unda oqsilning har bir orqa suyagi har ___________ qoldiqda to'liq spiralni yakunlaydi.

Shunga qaramay, oqsilning orqa miya qismidagi molekulalararo kuchlar bu strukturaviy motivni joyida ushlab turadi.

XVJ bu ipni qanday bo'lakda ushlab turibdi?

Yuqoridagi rasmda ushbu XVFda qaysi atomlar ishtirok etishini aniq ko'rsating.

2c. Ikkilamchi tuzilmalar: Alpha Helices

Spiral g'ildirak grafigi - bu siz o'qdan pastga qarab turgan alfa spiral qoldiqlarining ikki o'lchovli tasviridir.

Bu ketma-ketlik uchun spiral g'ildirak:

abcdeABCDE123456789

Mana alfa spiral hosil qiluvchi haqiqiy ketma-ketlik:

Ushbu ketma-ketlikdagi aminokislotalar uchun:

Yuqoridagi spiral g'ildirakdagi har bir aminokislota o'rnini, shu jumladan doiralar va qutilarni chizish orqali spiral g'ildiragini yarating. Leysin bilan boshlang a. Boshqa aminokislotalarni g'ildirak atrofida joylashtirishni davom eting.

Iloji bo'lsa, quvurlarni tozalash vositalari va strafor trubkasi yordamida qo'l modelini ham yarating.

Hidrofil qoldiqlarni aylana bo‘ylab aniqlang.

Hidrofobik qoldiqlarni boks orqali aniqlang.

Alfa spiralning qaysi yuzi suv eritmasiga duch kelishi mumkin?

Alfa spiralning qaysi yuzi oqsilning ichki qismiga to'g'ri keladi?

3. Uchlamchi tuzilmalar

Protein ikkilamchi tuzilish elementlarining ixcham globulyar birliklarga o'ralishi uchinchi darajali tuzilishoqsildan. Proteinlar shunday qadoqlanganki, buklangan oqsil ichida juda kam suv topiladi. Buklama tomonidan boshqariladi o'ziga xos bo'lmaganhidrofobik o'zaro ta'sirlar (suvdan gidrofobik qoldiqlarni ko'mish).

[Hidrofobik yoki hidrofilik] aminokislotalar oqsil yuzasida ko'proq topiladi. Birini aylana.

[Hidrofobik yoki hidrofilik] aminokislotalar katta ehtimol bilan katlanmış oqsilga ko'milgan holda topiladi. Birini aylana.

Agar Val yon zanjiri oqsilga ko'milgan bo'lsa (suv ta'sirida bo'lmasa), uning atrofida yana qaysi aminokislota yon zanjirlari bo'lishi mumkin?

4. To'rtlamchi tuzilmalar

To'rtlamchi tuzilishko'p bo'linmali oqsilning 3D tuzilishi va bo'linmalarning bir-biriga qanday mos kelishidir.

Agar bu monomer bo'lsa, tetramerning multfilmini chizing.

Subbirliklar tuz ko'prigi va vodorod bog'lanishini o'z ichiga olgan holda tutiladi. Rasmda XVFning ushbu diqqatga sazovor joylarini aniqlang.

Toʻrtlamchi oqsil tuzilishi a.ga misol boʻla oladi [polimer yoki supramolekulyar birikma] ? Birini aylana.

Protein qatlamlari

Protein qatlamlarioqsil strukturasi o'zining funktsional shakli yoki konformatsiyasini qabul qilish jarayonidir. Bu polipeptidning tasodifiy sariqdan o'zining xarakterli va funktsional uch o'lchovli tuzilishiga katlanadigan jismoniy jarayoni.

Protein denaturatsiyasi

Denaturatsiyaoqsillar buklangan holatda mavjud bo'lgan ikkilamchi yoki uchinchi darajali tuzilishini yo'qotadigan jarayondir.

Denaturatsiya jarayoni uchun multfilm chizing.

Molekulyar darajada, oqsil denatüratsiyalanganda nima sodir bo'lishini tasvirlab bering.

Denatüratsiyaga olib kelishi mumkin bo'lgan 2-3 xil narsani taklif qiling.

Agar tirik hujayralardagi oqsillar denatüratsiya qilinsa, hujayra bilan nima sodir bo'lishi mumkin?

Protein amaliyoti muammolari

Treoninning barcha mumkin bo'lgan stereoizomerlarini chizing va har biriga R, S nomenklaturasini belgilang.

Quyidagi peptidning tuzilishini chizing:

Oqsillarning (alfa) - spiral segmentlari zanjirda prolin uchraganda to'xtaydi. (alfa)-spiralda prolin topilmasligi sababini ko'rsating.

Pro - bu eng ko'p (eta)-burilishlarda topilgan aminokislotadir. Ushbu kuzatuvning sabablarini muhokama qiling.

Foldit - bu muhim ilmiy tadqiqotlarga hissa qo'shish imkonini beruvchi inqilobiy yangi kompyuter o'yini.

Dartnell, Lyuis yangi olim. 11/8/2008, jild. 199 (2681), 36-39-betlar.

Veb-saytda va/yoki New Scientist maqolasida protein katlama o'yini haqida o'qing.

Proteinni katlamaga harakat qiling. O'qituvchingiz shaxsiy guruh o'rnatgan yoki yo'qligini tekshiring! https://fold.it/portal/node/996074

Quyidagi savollarga javob beradigan xulosa (o'z so'zlaringiz bilan):

Nima uchun olimlar oqsillarni katlamaga qiziqishadi?

Nega uni kompyuter o'yiniga aylantirgandan ko'ra, tuzilmani faqat kompyuter hal qiladi?

Qaysi proteinni yig'ishga harakat qildingiz?

Nima uchun proteiningiz muhim edi?

Urinishlaringizning skrinshotini taqdim eting. (Yoki o'qituvchingiz shaxsiy guruh yaratgan bo'lsa, u sizning urinishlaringizni kuzatishi mumkin).

Retseptorlar nazariyasi

The faol saytmolekulalar bog'lanib, kimyoviy reaksiyaga kirishadigan yoki javobni qo'zg'atadigan ferment yoki retseptorning 3 o'lchamli yivi yoki cho'ntagi.

Faol sayt bilan o'zaro ta'sir qilish uchun substrat:

a) aminokislotalar yon zanjirlari bilan molekulalararo kuchlar bilan faol joyni ushlab turishi kerak.

b) faol saytga &ldquofit&rdquo kerak. (o'lcham va geometriya va yo'nalish)

A. Bog'lanish: elektrostatik kuchlar

Substratlar retseptorlar va fermentlar bilan kovalent yoki kovalent bo'lmagan o'zaro ta'sirlar orqali bog'lanadi.

Quyida ferment bilan o'zaro ta'sir qiluvchi peptid molekulasining bir qismi (ichki doira) multfilmi keltirilgan. Chiziqli chiziqlar substratni fermentga ushlab turgan molekulalararo kuchlarni ko'rsatadi.

B. Bog'lash: Fit, o'lcham va geometriya

Retseptorlar va fermentlar 3 o'lchovli shaklga ega, shuning uchun substratning tuzilishi mos bo'lishi kerak.

C. Bog'lanish: Stereokimyo

Bundan tashqari, stereokimyo katta farq qiladi. Quyida ikkita enantiomerning multfilmi va ularning retseptor bilan o'zaro ta'siri.

Qachon tuzilishi A bog'laydi, u barcha mumkin bo'lgan o'zaro ta'sirlardan to'liq foydalanadi (qo'lqopdagi qo'l yoki qulfdagi kalit kabi &ndash u juda mos keladi). Uning enantiomeri, tuzilishi B, barcha o'zaro ta'sirlardan foydalana olmaydi.

Strukturadir A yoki tuzilishi B qattiqroq bog'langanmi? Birini aylana.

Strukturaning Nyuman proyeksiyasini chizing B 60, 120 va 180 daraja aylantirildi.

Strukturaning har qanday moslashuvi B barcha mumkin bo'lgan bog'lash cho'ntaklaridan to'liq foydalanishga qodirmi?

Quyidagi deyterlangan birikmaning faqat bitta izomeri defosforilaza uchun substrat bo'lib, u eliminatsiyaga qarshi ta'sir ko'rsatadi. Z-izomer (quyida ham ko'rsatilgan).

Ushbu ikki izomerda stereosentrlarni R yoki S bilan belgilang.

Bu izomerlar bir-biri bilan qanday bog'liq?

enantiomerlar diastereomerlar konformerlar

Retseptorlar nazariyasidan foydalanib, nima uchun bu izomerlardan faqat bittasi ferment bilan reaksiyaga kirishib, mahsulot hosil qilishini tushuntiring.

Proteinlarni qo'llash muammolari

Nikotin retseptorlari bilan bog'lanish

Ligandning retseptor yoki ferment bilan qanchalik ko'p o'zaro ta'siri bo'lsa, ular bir-biri bilan shunchalik kuchliroq bog'lanadi.

Asetilkolin (quyida ko'rsatilgan tuzilma) nikotinik retseptorning bir bo'linmasidagi tanib olish joyi bilan o'zaro ta'sir qiladi.

Asetilkolin bilan o'zaro ta'sirini ko'rsating.

Dori vositalarini loyihalashning stereokimyosi.

Preparatning stereokimyosi haqida quyidagi maqolani o'qing: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC353039/

Xiral preparatning bir enantiomerining ferment bilan qanday bog'lanishini ko'rsatadigan multfilm chizing.

Faqat bitta faol enantiomerga ega bo'lgan joriy dori misolini keltiring.

Hozirgi vaqtda Qo'shma Shtatlar yoki Evropada yangi dori-darmonlarni ishlab chiqish bo'yicha hech qanday tartibga soluvchi mandat yo'q, chunki faqat bitta enantiomerlar va farmatsevtika kompaniyasi yangi dori uchun rasemik yoki sof enantiomerdan foydalanishni tanlashi mumkin. FDA bozor uchun enantiomerik jihatdan toza dori-darmonlarni talab qiladimi yoki yo'qmi, dalil qiling.

Membran ion kanallari sifatida siklik peptidlardan nanotubalar

Tsiklik peptidlar hujayra membranalarida o'z-o'zidan yig'ilib, trans-membran hajmi bo'yicha selektiv ion kanallarini hosil qiladi va biologik ahamiyatga ega bo'lgan molekulalarni, masalan, glyukozani lipid ikki qavati bo'ylab o'tkazadi. Biophys J. 2003 yil 85 oktyabr (4): 2287&ndash2298 Chem. Soc. Rev., 2012, 41, 6023&ndash6041 J. Am. Kimyo. Soc. 1998, 120, 4417-4424

Tsiklik peptidlarni o'z-o'zidan yig'ish

Azotdagi H&rsquoslarning bir qismini CH3 bilan almashtirgan N-metillanish o'z-o'zini yig'ish jarayonini ikkita subbirlik bilan cheklaydi (faqat dimer hosil qiladi, quyidagi rasmga qarang).

Stackable siklik peptidlarni nima ushlab turadi (quyidagi rasmga qarang)?

Buni quyidagi rasmda chiziqli chiziqlar yoki yoritgich yordamida ko'rsating.

Nima uchun N-metilatsiyadan keyin faqat ikkita subbirlik bir-biriga bog'lanishi mumkinligini tushuntiring.

Nanotubalar (davomi): Tsiklik peptid dizayni

Yuqorida ko'rsatilgan siklik peptiddagi aylana bo'lgan funktsional guruhni nomlang.

Yuqoridagi siklik peptidda nechta chiral markaz mavjud?

Ushbu siklik peptid uchun qancha stereoizomerlar bo'lishi mumkin?

Quyidagi katakchada takozlar va chiziqlar yordamida quyidagi peptid magistralida R stereoizomeri sifatida ikkita alanin (Ala) yon zanjirini chizing.

Quyidagi aylanada takozlar va chiziqlar yordamida ikkita alanin (Ala) yon zanjirlarini, biri R va ikkinchisi S stereoizomerini quyida joylashgan peptid magistraliga chizing.

Maqsad ichi bo'sh naychalar (nanotubalar) yasashdir. Yuqoridagi rasmlaringizdan foydalanib, nima uchun ular R va S aminokislotalar o'rtasida tsiklik peptid atrofida o'tishlari kerakligini tushuntiring.

Nima uchun har bir siklik peptid juft sonli aminokislotalardan tashkil topgan?

Nanotubalar (davomi): Hujayra membranasi orqali kanallar hosil bo'lishi

Supramolekulyar stacked siklik peptidlar hujayra membranasi orqali ion va transport kanallarini (naychalarini) yaratish uchun ishlatiladi.

Tsiklik peptidni yaratish uchun keng tarqalgan bo'lib ishlatiladigan aminokislotalar - fenilalanin (Phe), alanin (Ala), leysin (Leu).

Ushbu aminokislotalarning yon zanjirlari bor: (to'g'ri javobni aylana bilan belgilang)

musbat zaryadlangan manfiy zaryadlangan qutbsiz

Quyidagi tsilindrdan chiqadigan ushbu aminokislotalardan ikkitasini chizing. Aminokislota yon zanjiri hujayra membranasining boshi yoki dumi bilan o'zaro ta'sir qilishini aniq ko'rsating.

Hujayra membranasidagi silindrlarni qanday molekulalararo kuchlar ushlab turadi?

Nanotubalar (davomi): Hujayra membranasi orqali ionlar va glyukozani tashish

Tsiklik peptid hosil qilish uchun turli xil miqdordagi aminokislotalar ishlatilsa, teshik hajmi (ichki diametri) o'zgaradi.

Aminokislotalar soni Teshik hajmi ( Kanalga nima mos keladi
4 4
8 8
10 13

Hujayra membranalarida o'z-o'zidan yig'iladigan siklik peptid kanallari bo'yicha joriy tadqiqotlar dori vositalarini etkazib berish va antibakterial tadqiqotlarni o'z ichiga oladi.

Glyukozani eng barqaror kreslo konformatsiyasida torting.

Fe (CN) dagi Fe ning geometriyasi qanday?6 3- ?

Ushbu uchta tanlovning har biri yuqorida sanab o'tilgan kanallardan biriga yaxshi mos keladi. Bularni jadvalga qo'shing.

Na hajmini solishtiring+ va K + . Agar siz Na+ uchun selektiv kanal yaratmoqchi bo'lsangiz, qancha aminokislotadan foydalanasiz?

Biologik makromolekulaning ionlar/kichik molekulalar bilan o'zaro ta'sirini o'rganish

DNK va oqsillar kabi makromolekulalarning biologik funktsiyasi har doim boshqa molekulalarning ular bilan bog'lanishini o'z ichiga oladi. Biokimyogarlar bu boshqa molekulalar yoki ionlarni ligandlar deb atashadi. Ligandlarning oqsillar va nuklein kislotalar bilan bog'lanishi siz allaqachon o'rgangan tanish molekulalararo kuchlar orqali sodir bo'ladi. Ushbu o'zaro ta'sirlarni makromolekulaning 3D tuzilishini ko'rish orqali tasavvur qilishingiz mumkin: rentgen kristalli koordinatalari oqsil ma'lumotlari bankida pdb fayllari shaklida saqlanadigan ligand kompleksi. Pdb-da Google qidiruvini bajaring va RCSB Protein ma'lumotlar bankiga havolalarni bajaring. U yerga kelgandan so'ng, yuqori menyudagi PDB ID yoki Matn qidirish satrlariga quyidagi jadvallarda ko'rsatilgan komplekslardan biri uchun PDB # ni kiriting. Bog'langan ligandni ko'rish uchun Ligand Explore deb nomlangan dasturdan foydalaning.

Ligand Explorer-ni ishga tushiring: Ushbu kompleks uchun ko'rsatilgan sahifaning o'rtasida joylashgan Ligand kimyoviy komponenti bo'limiga o'ting. Ligand nomi bilan qatorda Ligand Explorer-ni tanlang. Quyida misol keltirilgan.

Saytda qalqib chiquvchi oynalarga ruxsat berish so'ralishi mumkin. Agar shunday bo'lsa, ruxsat bering. Dasturni ishga tushirish uchun Ligand Explorer-ni qayta tanlashingiz kerak bo'lishi mumkin. Ligand Explorer ochilguncha ruxsat berish va ko'rsatmalarga amal qilishda davom eting. Ishga tushgandan so'ng, Yordam yorlig'ini tanlang va ko'rsatmalar brauzerda ochiladi. O'zaro munosabatlarning eng yaxshi ko'rinishini topishga yordam berish uchun sichqonchadan foydalaning.

Topshiriq: Har bir jadval noyob PDB tuzilmasini tanlaydi va sinfda bir sahifali PowerPoint dasturini taqdim etadi, unda siz skrinshotlar (pastga qarang) sizning oqsilingiz bilan ligand bog'lanishida ishtirok etuvchi IMFlar tasvirlangan aniq sarlavhalar bilan ko'rsatiladi.

Ligand Explorer-dan foydalaning: Ligand Explorer oynasining chap tomonida -

PDB fayllaridagi kislorod va azot atomlari ko'pgina displey dasturlarida mos ravishda qizil va ko'k rangda kodlangan. H aloqalari qizil O va ko'k N atomlari o'rtasida ko'rsatilgan, ular ham elektronegativ, ham bir oz manfiydir. X-nurli kristallografiya yordamida olingan struktura fayllarida H atomlari ko'rsatilmaydi. Vodorod aloqasi bilan bog'langan atomlardan birida H atomi bor deb faraz qilaylik.

Kesilgan ekran tasvirlarini olish: Kompyuter: Windows-ning pastki chap belgisini tanlang va Qidiruv dasturlarida Snipping Tool-ni kiriting. Ko'rsatmalarga amal qiling. Mac: Buyruq-Shift-4-ni tanlang. O'zaro faoliyat kursor paydo bo'ladi. Hududni tanlash uchun bosing va torting. Sichqoncha tugmachasini qo'yib yuborsangiz, skrinshot ish stolida PNG fayli sifatida saqlanadi.

A. Makromolekula: Dori vositalarining o'zaro ta'siri

Sinf Makromolekula Dori Tavsif PDB #
antibiotiklar D-alanil-D-alanin karboksipeptidaza penitsillin bakterial hujayra devorlarini quruvchi fermentni inhibe qiladi 1pwc
virusga qarshi OIV proteazasi saquinavir OIVning etukligi uchun zarur bo'lgan fermentni inhibe qiladi 1hxb
virusga qarshi neyramidaza tamiflu Tamiflu - bu grippga qarshi dori 2hu4
saratonga qarshi DNK bleomitsin faol o'sayotgan hujayralardagi DNK bilan bog'lanadi, ko'pincha DNK zanjirini parchalaydi 1mxk
saratonga qarshi Tubulin taxol tubulin bilan bog'lanib, hujayra bo'linishi paytida mikrotubulalar ta'sirini oldini oladi 1jff
saratonga qarshi DNK sisplatin DNK bilan bog'lanadi va natijada apoptozni (dasturlashtirilgan hujayra o'limi) qo'zg'atadigan o'zaro bog'lanishni keltirib chiqaradi. 3lpv
Hujayra signalizatsiyasi Beta-adrenergik retseptorlari karazolol beta-blokerlar yurak kasalliklarini davolashda ishlatiladigan adrenergik retseptorlarni bog'laydi va inhibe qiladi 2rh1
Hujayra signalizatsiyasi Prostaglandin H2 sintaza aspirin sikloksigenaza fermentini inhibe qiladi, bu esa og'riq signalini beruvchi prostaglandinlarni hosil qiladi. 1-p
Boylik kasalliklari Pankreatik lipaz alkilfosfonat oshqozon osti bezi lipazini inhibe qiladi, oziq-ovqatdan so'rilgan yog' miqdorini kamaytiradi. 1lpb
Boylik kasalliklari HMG-CoA reduktaza Atorvastatin (Lipitor) xolesterin sintezida ishtirok etadigan HMG-CoA reduktaza fermentini inhibe qiladi. 1hwk

B. Protein: uglevod (CHO) o'zaro ta'siri

Sinf Protein Karbongidrat Tavsif PDB #
Lektin va ndash (CHO bog'lovchi oqsil) Konkavalin A dimannoz Con A Jek Beandan olingan va uglevodlarni bog'laydigan oqsillarni o'rganish va tozalash uchun ishlatiladi 1I3H
tashuvchi Laktoza o'tkazuvchanligi Tiodigalaktozid (laktoza analogi) Escherichia coli laktoza o'tkazuvchanligi laktozani hujayra membranalari orqali tashiydi 1pv7
Inson lektinasi P-selektin SLEX (uglevod) SleX, tetrasaxariddiruglevod hujayralar yuzasida joylashgan. U hujayralarni tanib olishda ishtirok etadi va qon guruhining eng muhim antijenlaridan biridir. P-selektin - bu leykotsitlarda joylashgan oqsil, 1g1r

C. Protein: lipidlarning o'zaro ta'siri

Sinf Protein Dori Tavsif PDB #
Hujayralarda erimaydigan yog 'kislotalarini bog'lash Adipoctye lipidlarni bog'lovchi oqsil Araxadon kislotasi Yog 'kislotalari biokimyosida sikloksigenaza COX-2da ishtirok etadigan hujayra ichidagi oqsil (PDB kodi: 1CVU), 1adl
Qondagi yog 'kislotalarini bog'lash va tashish Inson sarum albumini stearin kislotasi, Albumin qon zardobida eng ko'p bo'lgan oqsildir. Yog 'kislotalari kabi qutbsiz molekulalarni bog'laydi 1e7i
Yog 'kislotalarini saqlash yog'laridan (triglitseridlar) ajratib oling Fosfolipaza A2 Oktil sulfat Triglitseridlardan yog 'kislotasini chiqaradi. Hujayralarda topilgan va hujayralardan ham ajralib chiqadi 3fvi

D. Protein: kichik molekulalarning o'zaro ta'siri

Sinf Protein Dori Tavsif PDB #
Gormon Estrogen retseptorlari Tamoksifen Tamoksifen, estrogen mimikasi, estrogen ta'sirini blokirovka qilish orqali saraton kasalligini davolash uchun ishlatiladi. 3ert
Toksik molekulalar P-glikoprotein siklik geksapeptid ingibitorlari, siklik-tris- (R)-valinselenazol Protein hujayralardan zaharli molekulalarni (afsuski, kemoterapevtik preparatlarni) olib tashlaydigan eng keng tarqalgan molekulyar nasosdir. 3g60
Toksik molekulalar Sitokrom P450 Eritromitsin (antibiotik) CYP3A4 sitoxrom p450 bo'lib, u dori detoksifikatsiyasida katta rol o'ynaydi va sotiladigan dori vositalarining taxminan 50% metabolizmiga hissa qo'shadi. 2j0d
Gormon Jinsiy gormonni bog'lovchi globlulin testosteron testosteron qondagi tashuvchi oqsillar, shu jumladan sarum albumin va jinsiy gormonlarni bog'lovchi globulinlar ichida tashiladi; 1d2s
Gormon testosteronni bog'lovchi domen tetrahidrogestrinon (THG) tetrahidrogestrinon (THG) sintetik dizayner anabolik steroiddir. 2amb
Neyrotrans Asetilxolin retseptorlari Karbamoil xolin Ushbu miya neyrotransmitter retseptorlari nikotinik kislota retseptorlari tizimining bir qismidir 1uv6
Neyrotrans Insonning D3 dopamin retseptorlari etikloprid Dopamin antagonisti bo'lgan etikloprid bilan kompleksda inson dopamin D3 retseptorlarining tuzilishi 3pbl

E. Protein: metallarning o'zaro ta'siri

Sinf Protein ion Tavsif PDB #
transport Transferrin Temir Transferrin qonda Fe ni olib yuradi, uni sekvestr qiladi va oksidlanishdan ko'proq erimaydigan 3+ temir shakliga o'tadi. 1 soat 76
saqlash Ferritin Temir Fe ionlarini sekvestr qiluvchi qobiq hosil qiluvchi hujayra ichidagi oqsil 1fha
Gen ifodasi Gal 4 Zn Zn ionlari oqsildagi &ldquoZn barmoq&rdquo strukturasini barqarorlashtirishga yordam beradi, bu uning gen faolligini bog'lash va tartibga solish imkonini beradi. 1d66
Javob berish uchun signal xujayrasi kalmodulin kaltsiy Kalmodulin (kaltsiy modulyatsiya qiluvchi oqsil), hujayra ichidagi Ca ionlarini bog'lab, shaklini o'zgartiradi va hujayra reaktsiyasini keltirib chiqaradi. 1xr

F. Protein: suiiste'mol o'zaro ta'sir dori

Tahlil qilish uchun ligandni tanlang

O'z navbatida vodorod aloqasini, hidrofobik, ko'prikli H aloqasini (suv molekulasi vositachiligida) va metallning o'zaro ta'sirini tanlang. Har bir shovqinning kesilgan skrinshotini oling.

Yakuniy renderlash uchun “Yuzalarni tanlash” tugmasini bosing shaffof emas. Keyin ligand bog'langan bo'shliqni ko'rsatish uchun masofani eng yaxshi tarzda o'zgartiring. Bo'yash hidrofobiklik bo'shliqning qutbsiz va qutbli qismlarini ifodalovchi ikkita rang beradi. Tanlang qattiq yuzalar.

Har bir renderda ko'rsatilgan o'zaro ta'sirlarni sinfda tushuntirishga tayyor bo'ling.

Kümülatif guruh uy vazifasi: Biokimyo&rsquos Keyingi Top Model

Siz hujayra membranasidan ajratilgan yangi oqsilni topdingiz. Protein ma'lumotlar bazasini dastlabki tekshirish sizning ketma-ketligingiz glyukozani hujayra membranalari orqali tashuvchi oqsillar bilan chambarchas bog'liqligini ko'rsatadi.

Endi siz uning ketma-ketligi asosida boshqa tizimli tafsilotlarni to'plashingiz kerak bo'ladi. Ushbu laboratoriya sizga kompyuter yordamida bajarishingiz mumkin bo'lgan ba'zi narsalarni, shuningdek, strukturani bashorat qilish cheklovlarini ko'rsatadi.

Yangi oqsilning asosiy ketma-ketligi quyida bir harfli kodlarda keltirilgan. Ushbu laboratoriyada siz ba'zi kompyuter ishlarini bajarasiz va keyin sim yordamida oqsilning jismoniy modelini yaratishga harakat qilasiz.

Tahlil uchun to'rt qism mavjud.

1-qism: Gidropatiya va membranani kesib o'tish

2-qism: Ikkilamchi tuzilmani bashorat qilish

3-qism: Model yaratish

4-qism: Kompyuter orqali uchinchi darajali tuzilma (ixtiyoriy)

Guruh a'zolarining ismlari:

MEDDDGGLCLAVLVAMFFLGIMLLPSLANPPGRKGALLFAAIFCILAILMGVSAEG PKNRGALGIVLAAALCLVAIFGLRNQQSNSDGWPILLALTAQLAALCVLLLPFFPE SPRYQKKS

1-qism: Gidropatiya va membranani kesib o'tish

Aksariyat membrana bilan bog'langan oqsillar hujayra membranasini bir necha marta kesib o'tadi, shuning uchun birinchi qadam oqsilning gidropatiya sxemasini qurishdir. Bu sizga oqsilning hujayra membranasini necha marta kesib o'tishini taxmin qilish imkonini beradi. Quyidagi gidropatiya shkalasi hidrofobik yon zanjirlar uchun ijobiy ball va hidrofilik yon zanjirlar uchun salbiy ball beradi.

Oddiy gidropatiya syujetini tuzing:

Oddiy gidropatiya syujetini yaratish uchun sizga Next_Top_Model_Data nomli MS Excel faylini oching. 1-ustunda aminokislotalar ketma-ketligi, 2-ustunda esa # qoldiq mavjud. 3-ustunga gidropatiya ballarini qo'shing va keyin 2D formatida &lsquoUstun grafik&rsquo yarating.

Gidropatiya uchastkalari ko'rib chiqilayotgan qoldiqdan oldin va keyin qoldiqlarning o'rtacha qiymatidan foydalanadi. Quyidagi misolda C4 hujayradagi aspartik kislota uchun o'rtacha gidropatiya balli C2 dan C6 gacha bo'lgan hujayralardagi o'rtacha balldir. Excel D4 yacheykada o'rtacha qiymat hosil qilishi uchun &lsquo=average(C2:C6)&rsquo yozishingiz mumkin. Keyin D4 katakning pastki o'ng burchagini ustun bo'ylab pastga torting. (1 va 2 qoldiqlar uchun o'rtacha qiymat bo'lmaydi.) Endi sizda o'sha qoldiqni o'z ichiga olgan har bir qoldiq uchun o'rtacha gidropatiyaga ega bo'lasiz, undan oldingi ikkita va undan keyingi ikkita. Ushbu ma'lumotlar grafik maqsadlarda ishlatiladi.

O'rtacha gidropatiya (y o'qi) va qoldiq # ning 2D formatida &lsquoustun grafik&rsquo yarating. Excel qator raqamlarini ham tuzishi mumkin, shuning uchun grafikni o'ng tugmasini bosib, &lsquoMa'lumotlarni tanlang&rsquo ostidagi 1 yoki 2-seriyalarni o'chirishingiz kerak bo'lishi mumkin. # qoldiq x o'qida ekanligiga ishonch hosil qiling. (Excel 2007 da siz &lsquoDesign&rsquo paneliga o'tishingiz va &lsquoSwitch Axes&rsquo tugmasini bosishingiz kerak bo'lishi mumkin.)

Syujetingiz asosida quyidagi savollarga javob bering:

Sizning gidropatiya syujetingizdan oqsil hujayra membranasini necha marta kesib o'tadi? (Ijobiy va salbiy qiymatlar nimani ko'rsatishi mumkinligini ko'rib chiqing.)

Membranani kesib o'tish uchun qancha aminokislotalar kerak bo'ladi?

Agar oqsilning N uchi hujayra ichida bo'lsa, 30-35 qoldiq qayerda joylashgan?

C-terminus hujayra ichidagimi yoki hujayradan tashqarimi?

Yon zanjirlar va asosiy zanjir atomlarining a-spiral va b-torchalardagi umumiy joylashuvi haqida bilganingizni hisobga olsak, membranani kesib o'tgan qismlar a-spiral yoki b-torcha bo'lishi mumkinligiga ishonasizmi? (Eslatma: Bu savolga keyinroq javob beriladi, shuning uchun bu erda ma'lumotli taxmin/gipoteza qiling.)

Ixtiyoriy: Adabiyotda odatda gidropatiya uchun nuqtalarni bog'laydigan chiziq bilan XY-tarqalish chizmalari ko'rsatilgan. Ular keng tarqalgan, ammo o'qish qiyinroq.

Aminokislota gidropatiyasi ballari

Aminokislota nomi Bir harfli kod Gidropatiya reytingi
Izoleysin I 4.5
Valin V 4.2
Leysin L 3.8
Fenilalanin F 2.8
Sistein C 2.5
Metionin M 1.9
Alanin A 1.8
Glitsin G -0.4
Treonin T -0.7
Triptofan V -0.9
Serin S -0.8
Tirozin Y -1.3
Prolin P -1.6
Histidin H -3.2
Glutamik kislota E -3.5
Glutamin Q -3.5
Aspartik kislota D -3.5
Asparagin N -3.5
Lizin K -3.9
Arginin R -4.5

Gidropatiya balli ma'lumotnomasi: Kyte, J. va Doolittle, R. 1982. Proteinning gidropatik xarakterini ko'rsatishning oddiy usuli. J. Mol. Biol. 157: 105-132.

2-qism: Ikkilamchi tuzilmani bashorat qilish

To'g'ridan-to'g'ri birlamchi oqsillar ketma-ketligidan 3D strukturasini bashorat qilish biokimyoning "muqaddas don" dir. Hozirgi vaqtda buni faqat juda o'xshash oqsilning tuzilishi ma'lum bo'lgan taqdirdagina amalga oshirish mumkin. Ikkilamchi strukturaviy elementlarni nisbiy aniqlik bilan bashorat qilish mumkin, ammo tadqiqotlar shuni ko'rsatdiki, ba'zi aminokislotalar a-spiral yoki b-simchalarda bo'lish ehtimoli ko'proq. Ushbu qismda siz ketma-ketlikni olasiz va ba'zi ikkilamchi strukturaviy elementlarni bashorat qilasiz. ga boring SCRATCH oqsillar bilan bog'liq ko'plab funktsiyalarni bajaradigan dasturlarga ega veb-sayt. U erda elektron pochta manzilingizni kiriting, laboratoriyaning birinchi qismida ko'rsatilgan ketma-ketlikni kiriting va keyin bosing SSPROquti. Bir necha daqiqadan so'ng siz yuborgan har bir aminokislota qoldig'ining kodi bilan elektron pochta xabarini olasiz. (Bu sizning keraksiz pochtangizga tushishi mumkin.)

The SSPRO chiqish uchta mumkin bo'lgan kodga ega. Chiqishni quyida joylashtiring.

H = Spiral

E = Kengaytirilgan beta tuzilmasi

C = Burilishlar, halqalar va aniqlanmagan tuzilmalar

Ikkilamchi tuzilmani bashorat qilish asosida ushbu savollarga javob bering:

Ketma-ketlikning ehtimoliy transmembran segmentlari SCRATCH dasturining spiral segmentlari bilan qanday mos keladi? (Bu SCRATCH natijalarini 1-sahifadagi asosiy ketma-ketlikning ostiga joylashtirishga yordam berishi mumkin.)

Hujayra membranasi qalinligini baholash uchun a-spirallar va ma'lumotlaringiz haqidagi quyidagi faktlardan foydalaning.

(alfa)-spiral har 3,6 qoldiqda burilish qiladi. Har bir burilish balandligi yoki oldinga siljish 0,54 nm (nanometr).

30-33 qoldiqlari (PPGR) spiral 1 va spiral 2ni bog'laganga o'xshaydi. 1 va 2 spirallar orasidagi qoldiqlar soniga ko'ra 30-33 qoldiqlari qaysi strukturani ifodalaydi?

Spiral 1 prolin mavjud bo'lgan taxminan 30 qoldiqda tugaydi. Nima uchun prolin a-spiral oxirida paydo bo'lishi mantiqiy ekanligini tushuntiring. (Maslahat: H-bog'lanish namunasi haqida o'ylab ko'ring.)

Quyida membrananing ikki qavati ko'rsatilgan (uning ostidagi maydon hujayra ichida deb faraz qiling). Rasmdan nusxa oling va uni kompyuteringizdagi Paint dasturiga yuklang. (Dastur dasturlar roʻyxatida &lsquoAccessories&rsquo boʻlimida joylashgan.) Paint-da oʻrta oʻlchamdagi nuqta bilan boʻyoq choʻtkasini tanlang va sichqoncha bilan oqsilni chizib oling. Har bir spiralda taxminan 5 burilish ko'rsatishga harakat qiling, chunki ular membranani qamrab oladi. Tugatganingizdan so'ng, faylingizni saqlang va uni yana ushbu hujjatga joylashtiring. Asl nusxani o'chirishingiz mumkin.

3-qism: Uchinchi darajali/3D tuzilmasi3-qism: Uchinchi darajali/3D tuzilmasi

Yuqorida ta'kidlab o'tilganidek, 3D tuzilmasini bashorat qilish juda qiyin, chunki birlamchi ketma-ketlikda bir-biridan uzoqda joylashgan qoldiqlar 3D tuzilmasida bir-birining yonida joylashgan bo'lishi mumkin. Laboratoriyaning ushbu qismida siz sim va boshqa turli xil materiallar yordamida oqsilingizning jismoniy modelini yaratishga harakat qilasiz. Eng yaxshi ko'rinishdagi model ajoyib sovringa ega bo'ladi! Model uchun ba'zi taxminlar:

Har bir aminokislota qoldig'ining uzunligi 1 dyuymga teng deb faraz qiling. Ketma-ket 120 ta aminokislotadan iborat bo'lgani uchun sizga 120 dyuymli (10 fut) sim kerak bo'ladi. bir necha turlari mavjud. E'tibor bering, ba'zilarining o'tkir qirralari bor.

N-terminusni ko'k rangga, C-terminusni esa qizil rangga bo'yang. (master ustiga lenta qo'shsangiz, bulg'anishning oldini oladi)

Agar siz (alfa)-spiralni qursangiz, spiralning bir burilishi 3,6 dyuymli sim bo'lishi kerak. Burilishni (alfa)-spiralda bog'laydigan H-bog'lari bo'lishi kerak

Bir-biridan 0,6 dyuym masofada va bir xil spiralda "pastadirdan pastadirga" o'ting. H-bond misollarini qo'shish uchun bir nechta qisqa simlarni sinab ko'ring.

Hujayra membranasida bo'lmagan halqalar va kengaytirilgan tuzilmalar uchun har bir qoldiq uzunligi 1 dyuym bo'lgan simni cho'zing.

Tartibda, shuningdek, disulfid bog'lanishlarida ko'rinadigan 4 ta sistein qoldiqlari mavjud. Spiraldagi sisteinning taxminiy pozitsiyalari quyida keltirilgan. Eng mantiqiy disulfid aloqalarini yaratish uchun qisqa qizil simdan foydalaning.

N va C terminallari orasidagi masofani o'lchash orqali strukturangiz qanchalik siqilganligini ko'rib chiqing. Agar cho'zilgan bo'lsa, sim 10 fut.

4-qism: Uchinchi darajali tuzilmani bashorat qilish (ixtiyoriy)

Laboratoriyaning yakuniy ixtiyoriy qismi sifatida siz SCRATCH veb-sayti tomonidan taqdim etilgan 3D shakl bashoratchisini sinab ko'rishingiz mumkin. ga boring SCRATCH veb-saytga o'ting va elektron pochta manzilingizni qo'shing va laboratoriya boshidan boshlab ketma-ketlikda joylashtiring. Bu safar 3Dpro oynasini bosing va siz 3D tuzilishining kompyuter prognozi bilan elektron pochta xabarini olasiz. (Bu 30 daqiqagacha vaqt olishi mumkin va struktura ilova bo'ladi.) Strukturani olganingizdan so'ng uni sichqonchaning chap tugmasi bilan siljitishingiz mumkin va o'ng sichqonchangizda rang va hokazolar mavjud.)

Eslatma:Agar protein to'g'ri ko'rsatilmasa, strukturani o'ng tugmasini bosing va &lsquoDisplay&rsquo ostida &lsquoBackbone&rsquo-ni tanlang.

IV. Baza Juftliklar -> DNK Spirallar

DNK nuklein kislota monomerlaridan tashkil topgan polimerdir.

DNK juft spiral shaklida bir-biriga mahkam ushlangan bir juft polimerdan iborat.
Ikki tomonlama spiralni o'ralgan narvon sifatida tasavvur qiling. Yon tomonlari takrorlanuvchi shakar-fosfat naqshidan iborat bo'lib, iplar orasidagi pog'onalar asosiy juftlikdir.

DNK bir necha molekulalararo kuchlar ta'sirida barqarorlashgan barqaror molekuladir.

Ushbu ikki DNK zanjiri orasidagi vodorod bog'lanishini chizing.

Qaysi asoslar DNKda bir-biri bilan &ldquopair&rdquo?

Ushbu juftlarning har biri o'rtasida nechta vodorod bog'i hosil bo'ladi?

AG va KT asoslari juftligi odatda yuzaga kelmaydi. Keling, bir nechta sabablarni ko'rib chiqaylik.

DNKni narvon sifatida tasvirlang (pastda).

Narvon rasmidan foydalangan holda AG va KT juftliklarida ikkita muammo mavjud:

A va G juda [katta yoki kichik] _________________ kuchlanishga olib keladi.

C va T juda [katta yoki kichik] _____________ zaiflashadi. Kulon qonuni haqida o'ylab ko'ring.

Vodorod bog'lanishi nuqtai nazaridan:

A:G asos juftidagi vodorod aloqalari sonini C:G tayanch juftligidagi vodorod aloqalari soni bilan solishtiring (oldingi sahifa).

Qaysi biri barqarorroq bo'lar edi?

DNK bazasi juftligini qo'llash muammosi

A siyanofag siyanobakteriyalarni yuqtiruvchi virusdir.

S-2L siyanofagida adenin o'rniga diaminopurin (DAP) ishlatiladi. DAP tayanch juftligi timin bilan mukammal birlashadi va 3 ta molekulyar vodorod aloqasini hosil qiladi.

3 ta vodorod aloqasini aniqlang.

A-T 2 ta vodorod aloqasini hosil qiladi. Adenindan DAPga o'tish siyanofag virusiga bakterial xostning immunitet tizimidan qochishga yordam beradi, deb taxmin qilingan.

DAP virusning omon qolishiga qanday yordam berishining sababini taklif qiling.

Rozalind Franklin (va Uotson va Krik) DNK tuzilishini aniqlashdan oldin, Chargaff DNKning turidan qat'i nazar, DNKdagi A + G ning umumiy miqdori C + T miqdoriga teng ekanligini ta'kidladi. Ushbu kuzatishni tushuntiring.

Quyida ko'rsatilgan bir zanjirli oligomerni ko'rib chiqing:

Fosfat funktsional guruhlarini aylantiring.

Shakar atrofida bir quti qo'ying.

Asosiy juftliklar orasidagi o'zaro ta'sirlarni ko'rsatadigan to'ldiruvchi ipni chizing.

DNK ning bitta zanjiri bunga misoldir [polimer yoki supramolekulyar birikma] ? Birini aylana.

Bunga DNK qo'sh spiral misol bo'la oladi [polimer yoki supramolekulyar birikma] ? Birini aylana.

Xiral DNK spiral

Spirallar o'ng yoki chap qo'lda bo'lishi mumkin.

Agar siz uni o'zingizdan uzoqlashtirgan holda ushlab tursangiz va u soat yo'nalishi bo'yicha aylansa, u o'ng qo'l, aks holda chap qo'ldir. Ushbu modellar ko'zgu tasvirlari bo'lib, ularni aylantirish orqali boshqasiga aylantirib bo'lmaydi.

DNKning A va B shakllari o'ng qo'lli spiraldir, Z-DNK esa chap qo'l spiraldir.

Ushbu rasmdagi DNK o'ng qo'l yoki chap qo'lli spiralmi?

DNKning denaturatsiyasi

Ikki tomonlama spiralli DNKning ikkita zanjiri nisbatan zaif kovalent bo'lmagan o'zaro ta'sirlar (vodorod bog'lanishi va asos stacking) orqali bir-biriga bog'langan va juda oson ajralib turadi. denaturatsiya.Isitish natijasida yuzaga keladigan denaturatsiya DNKning erishi deb ataladi. DNK namunasining 50% denaturatsiya qilingan harorat deyiladierish harorat (Tm).

Uchta DNK namunasi uchun erish haroratini (Tm) aniqlang

Ikki spiralli DNK namunasining Tm ga ta'sir etuvchi barcha omillarni sanab o'ting

Eslatib o'tamiz, A: T asos juftlarida ikkita vodorod aloqasi mavjud va G: C asos juftlarida uchta. Boshqa barcha parametrlar bir xil bo'lsa, erish nuqtasi DNKning G: C tarkibi bilan belgilanadi (G: C tarkibi qanchalik yuqori bo'lsa, harorat shunchalik yuqori bo'ladi).

Nazariy Tm ni hisoblashning juda oddiy usullaridan biri har bir A:T juftligi uchun 20 C va har bir G: C juftligi uchun 4 0C ni belgilashdir. Tm ikki zanjirli DNKdagi barcha alohida juftliklar uchun bu qiymatlarning yig'indisidir.

Nazariy T ni hisoblangm quyidagi DNK uchun

Turli DNK molekulalarining erish nuqtasi molekula va rsquos GC tarkibiga nisbatan chizilganda, quyida ko'rsatilgandek chiziq olinadi:

DNK molekulasining erish nuqtasini (0C, 100 mM Na+) hisoblash uchun ishlatiladigan chiziqli tenglama: Tm = 64,9 + 0,41* (%GC) &ndash (500 /DNKning asosiy juftligi soni)

  • Yuqoridagi tenglamadan foydalanib, uzunligi 500 bp bo'lgan va 50% GC tarkibiga ega bo'lgan DNK molekulasining erish nuqtasini hisoblang.

Floresan yorliqli DNK yordamida bitta molekula tadqiqotida katta yutuqlarga erishildi. YO-PRO (quyida ko'rsatilgan tuzilma) bu &ldquointercalation&rdquo (asosiy juftlar o'rtasida teskari qo'shilish) mexanizmi orqali ikki zanjirli DNK bilan bog'langan oksazol bo'yoqidir. Yaqinda tadqiqotchilar 30 ta asosli juft dupleks DNK ning erish harorati 2 ga oshganligini xabar qilishdi.

YO-PRO bo'yog'i egallagan har bir interkalatsiya joyi uchun 20C.

  • YO-PRO tuzilishiga asoslanib (quyida ko'rsatilgan) erish haroratining oshishi uchun tushuntirishni taklif qiling (T)m).

DNK-oqsil komplekslari

DNK juda katta va u hujayraning kichik yadrosida saqlanishi kerak. Eukariotlarda DNKni saqlash uni gistonlar deb ataladigan kichik oqsillar bilan bog'lash orqali amalga oshiriladi.

DNK molekulasining umumiy zaryadi qancha? _______________

Gistonlar DNK bilan ionli bog'lanish hosil qilganligi sababli, giston oqsillarining yon zanjirlarida qanday zaryadni ko'rishingizni taxmin qiling.

Ishtirok etishi mumkin bo'lgan ba'zi tipik aminokislotalarni sanab o'ting.

Multfilmdagi giston va DNK zanjiri o'rtasidagi ionli bog'lanishni ko'rsating:

Bu bog'lanish DNKdagi tayanch juftlarining ketma-ketligiga bog'liqmi?

DNK-oqsil komplekslari

Gistonlar DNK bilan qattiq bog'lanib, transkripsiyani oldini oladi.

DNKni transkripsiya qilish vaqti kelganida (kerakli protein ishlab chiqarish uchun), gistonlar DNKdan ajralib chiqishi kerak.

Gistonlar atsetillanishi mumkin: asetil (CH3CO) guruhlari aminlarga biriktirilgan.

Qo'shimcha muammolar

DNKda katta va kichik truba mavjud. Ushbu yivlarni tasavvur qilish uchun ushbu saytdagi DNKga qarang: http://employees.csbsju.edu/hjakubow. NAtutorial.htm

Ba'zi oqsillar DNK bilan vodorod bog'lanish orqali bog'lanadi. Modelga asoslanib, vodorod bog'lanish donorlari va qabul qiluvchilar qayerda ko'proq?

Major Groove Minor Groove

DNK bilan bog'langan oqsilning ushbu modeliga qarang:

RNK, DNKdan farqli o'laroq, asos sifatida dezoksiriboza o'rniga riboza va timin o'rniga urasildan foydalanadi.

Ushbu shakar tuzilmalaridagi farq(lar)ni aniq aniqlang.

Ushbu nuklein asos tuzilmalaridagi farq(lar)ni aniq aniqlang.

Timin va urasilning tuzilishi yuqorida ko'rsatilgan. Qisqa RNKda urasil bilan asos bog'lashi mumkin bo'lgan boshqa asosning tuzilishini chizing

Dorilar XVF orqali oqsilning &ldquoaktiv joyi&rdquo bilan qanday bog'lanishi va oqsil faolligini inhibe qilishi mumkinligini ko'rdingiz. Protein faolligini inhibe qilishning inqilobiy yangi usuli bu ma'lum bir protein ketma-ketligini hosil qilish uchun dekodlangan RNK bilan molekulani bog'lashdir. Bu protein hosil bo'lishiga to'sqinlik qiladi. Agar &ldquodrug&rdquo boshqa RNK bo'lsa, bu usul deyiladi RNK aralashuvi.

Quyidagi yuqori chiziq ma'lum bir oqsil uchun RNK ketma-ketligining bir qismidir.

RNKning katlanishi

Bitta zanjirli RNK oqsillar kabi o'z-o'zidan buklanib, murakkab &ldquottertiar&rdquo tuzilmalarni hosil qilishi mumkin. Ularda molekula ichidagi H-bog'lari bilan barqarorlashtirilgan &ldquduble-torli&rdquo spirallarning (&ldquikkilamchi tuzilish&rdquo) qisqa hududlari mavjud.

&ldquofolded&rdquo ssRNKda topilgan keng tarqalgan tuzilmalardan biri quyida ko'rsatilgan poya/soch tolasi halqasidir.

RNK bazasi qisqartmalaridan foydalanib: A, G, C va U, pastdagi soch turmagi tuzilishiga RNK asoslarini qo'shing, bu esa barqaror soch turmagi hosil bo'lishiga imkon beradi.

Poyadagi/soch ipidagi halqa oqsilni tanib olish joyi bo'lib xizmat qilishi mumkin.

dsRNKning 3 xil cho'zilishi bo'lgan buklangan ssRNKning bir halqasi bilan o'zaro ta'sir qiluvchi oqsil multfilmini chizing.

RNKni qo'llash muammosi

RNK qancha uzun bo'lsa, ildiz/soch tolasi tuzilmalarini bashorat qilish shunchalik qiyin bo'ladi, chunki ko'p bo'lishi mumkin. Kompyuter dasturlari buni biz uchun qila oladi.

mFold veb-serveriga o'ting http://mfold.rna.albany.edu/?q=mfold

Yuqori chapdagi RNK katlama formasi havolasini tanlang

Test tuzilmasi nomini kiriting (Testdan foydalaning)

Quyidagi bitta zanjirli RNK ketma-ketligini kiriting (ma'lumotlarni kiritish qulayligi uchun uchlik juftlikda keltirilgan):

GAG ACA UCC AUU GAU ACA CGG GUU UUA UUU AUC AAU GGA UGU CUC

Boshqa barcha tanlovlarni standart qiymatlarida qoldirib, pastga aylantiring va FOLD RNK ni tanlang

Chiqish oynasida Struktura 1 uchun rasm faylini (jpg, png) tanlang va uni chop eting.

Soch ipining barqarorligini oshiradigan yoki kamaytiradigan tuzilishga ikki xil o'zgartirish kiriting. Tahlilni qayta ishga tushiring. Ikkalasini ham chop eting.

RNKning katlanishi uchun kimyoviy tenglama yozilishi mumkin (xuddi biz almashtirilgan siklogeksan stul shakllarini o'zaro konvertatsiya qilish uchun qilganimiz kabi)

Ushbu reaksiya uchun &DeltaE ni chiqish faylining pastki qismida topish mumkin (dG = x). K ni topish uchun quyidagi formuladan foydalaning (stullarni o'zaro konvertatsiya qilishda qilganingiz kabi).ek va % buklangan


Protein ikkilamchi tuzilmalarida spirallarning har xil turlari qanday va ular qanday farqlanadi? - Biologiya

Biologiya 2960 Kompyuter laboratoriyasi

Ikkilamchi tuzilmalar aminokislotalar qoldiqlari orasidagi ichki vodorod bog'lanishi natijasida hosil bo'lgan tartibli tuzilmalardir. Umumiy ikkilamchi tuzilmalar &alfa-spiral, &beta-iplar va turli halqa va burilishlardir. Ikkilamchi tuzilmalar haqida qo'shimcha ma'lumot quyida keltirilgan.

Uchinchi darajali Polipeptidning tuzilishi - bu uch o'lchovli konformatsiya bo'lib, ular bir-biridan mustaqil ravishda katlanmış hududlarni tashkil qiladi. domenlar. Quyidagi rasmdagi domen gemoglobinning &beta-subbirligi uchun "gem bog'lovchi cho'ntak" dir.

Yagona intrahelikal vodorod aloqasi sezilarli strukturaviy barqarorlikni ta'minlamaydi, lekin &alfa-spiral ichidagi ko'plab vodorod bog'larining kümülatif ta'siri bu konformatsiyani barqarorlashtiradi. Aminokislota qoldiqlari orasidagi vodorod aloqalari, ayniqsa, suv molekulalari yopilgan oqsilning hidrofobik ichki qismida barqaror bo'ladi va shuning uchun vodorod bog'lanishi uchun raqobatlasha olmaydi.

&alfa-spiraldagi aminokislotalarning yon zanjirlari spiral silindridan tashqariga qaratilgan. &alfa-spiralning barqarorligiga yon zanjirlarning o'ziga xosligi ta'sir qiladi. Ba'zi aminokislotalar qoldiqlari konformatsiyalarda boshqalarga qaraganda tez-tez uchraydi. Masalan, alanin kichik, zaryadlanmagan yon zanjirga ega va &alfa-spiral konformatsiyasiga yaxshi mos tushadi. Alanin qoldiqlari oqsillarning barcha sinflarining &alfa-spirallarida keng tarqalgan. Aksincha, tirozin va asparagin katta yon zanjirlari bilan &alfa-spirallarda kamroq uchraydi. Yon zanjiri bitta vodorod atomi bo'lgan glitsin alfa-spiral tuzilmalarni beqarorlashtiradi, chunki uning &alfa-uglerod atrofida aylanish juda cheksizdir. Shu sababli, ko'plab spirallar glitsin qoldiqlari bilan boshlanadi yoki tugaydi. Prolin &alfa-spiralda eng kam tarqalgan qoldiqdir, chunki uning qattiq siklik yon zanjiri o'ng qo'lning spiral konformatsiyasini buzadi. Bundan tashqari, prolin o'zining amid azotida vodorod atomiga ega emas va intrahelikal vodorod bog'lanishida to'liq ishtirok eta olmaydi. Shu sabablarga ko'ra prolin qoldiqlari ichki qismga qaraganda &alfa-spirallarning uchlarida tez-tez uchraydi.

    Antiparallel va beta-varaqlar
    Antiparallel varaqda magistral karbonil kislorodlari va magistral amid protonlari mukammal tarzda joylashganki, ular to'g'ri vodorod aloqalarini hosil qiladi. Karbonil kislorod va amid vodorod (proton) vodorod bog'lovchi sherigiga to'g'ridan-to'g'ri qarama-qarshi joylashgan. Yon zanjirlar varaqning tekisligiga perpendikulyar ishora qiladi. Antiparallel konformatsiya barqarorroq va keng tarqalgan konformatsiyadir.

Tabiiy fanlar o'quv markazi
Vashington universiteti - Biologiya bo'limi
Mualliflik huquqi va nusxasi 2011 Vilgelm S. Kruz
Barcha huquqlar himoyalangan


Protein tuzilishidagi domen nima

Protein tarkibidagi domen oqsilning uchinchi darajali tuzilishidir. Bundan tashqari, u oqsilning boshqa tarkibiy qismlaridan mustaqil ravishda shakllanadi, mavjud va ishlaydi. Motif oqsildagi ikkilamchi strukturaviy elementlarning oʻzaro taʼsiri natijasida hosil boʻlsa-da, ikkinchi darajali struktura elementlari oʻrtasida yuzaga keladigan oʻzaro taʼsirlar domenda kuchliroq boʻladi. Bu erda ushbu ikkilamchi strukturaviy elementlar o'rtasida bir nechta turdagi bog'lanishlar paydo bo'lishi mumkin. Ulardan hosil bo'lgan aloqalarning asosiy turi disulfid ko'priklardir. Ular eng barqaror o'zaro ta'sirlardir.

2-rasm: Piruvat kinazning uchta domeni

Bundan tashqari, ikkilamchi tuzilmalarda musbat va manfiy zaryadlangan aminokislotalar o'rtasida ion aloqalari yoki tuz ko'prigi ham paydo bo'lishi mumkin. Bundan tashqari, uchinchi darajali strukturani barqarorlashtirish uchun vodorod aloqalari paydo bo'lishi mumkin. Boshqa tomondan, oqsil domenlari odatda globulyar tuzilishga ega va u suvda eriydi. Shuningdek, protein domeni oqsilning o'ziga xos funktsiyasini bajaradi. Umuman olganda, protein domenlarining to'rtta sinfini ll-a domenlari, ll-b domenlari, a+b domenlari va a/b domenlari aniqlash mumkin.


Yordamchi ma'lumotlar

S1-rasm. To'rtta asosiy SCOP sinfidagi spiral va iplarning nisbiy erituvchiga kirish imkoniyatlari (RSA) gistogrammasi.

Iplar barcha sinflarda sezilarli darajada ko'proq ko'milgan, ammo farq a/b domenlarida ayniqsa katta. Buning sababi, TIM bochkalari kabi ko'plab a / b domenlari hal qiluvchi kirish mumkin bo'lgan a spirallari bilan o'ralgan b iplarning markaziy yadrosi bilan tavsiflangan bo'lishi mumkin.

S2 rasm. SCOP sinflarida indellarning taqsimlanishi.

Indels chastotasi ketma-ketlik o'xshashligining kamayishi bilan ortadi (chap panellar) va spirallarda all-a va a+b domenlaridagi iplarga qaraganda yuqoriroq bo'ladi, lekin a/b domenlarida emas (o'ng panellar, 10–20 bilan juft tekislashdan foydalangan holda). % ketma-ketlik o'xshashligi).

S3-rasm. Bobinlar spiral yoki iplardan kamroq mustahkamdir.

Panellar 10-20% ketma-ketlik o'xshashligi bilan juft hizalanishdan olingan ma'lumotlarni ko'rsatadi, yulduzlar spiral va iplar o'rtasidagi sezilarli farqni ko'rsatadi (p & lt 0,05 Holm-Bonferroni tuzatishdan keyin). Bobinlar kamroq saqlanib qolgan bo'lsa-da, bu naqshning biologik talqini oddiy emas, chunki aksariyat hollarda spiral va iplar bir-biridan mustaqil ravishda o'zgaradi, bobinlar esa spiral yoki iplardan mustaqil ravishda o'zgarmaydi: ip yoki spiral bo'lganda. qoldiq lasanga o'zgaradi, bu ham bobinlarning o'zgarishi sifatida hisoblanadi. Natijada bobinlardagi o'zgarish miqdori spiral va iplardagi o'zgarishlar yig'indisiga yaqin bo'ladi.

S4-rasm. Alfa spirallardagi qoldiqlar beta iplardagi qoldiqlarga qaraganda ko'proq kontaktga ega va to'rtta SCOP sinfidagi iplar bobinlarga qaraganda ko'proq kontaktga ega (ANCOVA, p < 2E-16).

Qutilar 25-75% intervallarni, mo'ylovlar 10-90% ni bildiradi.

S5-rasm. Spirallarning yuqori mustahkamligi turli xil aminokislotalar tarkibining natijasi emas, individual aminokislotalar bir xil tendentsiyani ko'rsatadi.

A) All-alpha vs. all-beta domenlari. Sezilarli darajada turli xil RSA qutilari yulduzlar bilan belgilangan. (10-20% ketma-ketlik o'xshashligi bilan juftlik moslamalari, nisbatlar testlari, ahamiyatlilik darajasi 0,05, Holm-Bonferroni usuli bilan bir nechta taqqoslash uchun tuzatilgan.) B) a/b domenlari. C) a+b domenlari.

S6-rasm. Individual aminokislotalarning iplardagi kovalent bo'lmagan qoldiq o'zaro ta'siri spirallarga qaraganda kamroq.

A) RSA va glitsin uchun kontaktlar soni, spiral va iplardagi regressiyalar (barcha SCOP sinflarida p < 2e-16, ANCOVA). B) Kontaktlarning kesishishi o'rtasidagi farq - spiral va iplar uchun RSA regressiyasi. Ikkilamchi strukturaning kontaktlar soniga ta'siri barcha aminokislotalarda sifat jihatidan bir xil: spirallar barcha holatlarda sezilarli darajada ko'p kontaktlarga ega (p < 2e-16, ANCOVA).

S7-rasm. Protein ketma-ketligi bo'yicha o'rtacha aloqa masofasi (ya'ni strukturadagi kovalent bo'lmagan qoldiq o'zaro ta'siri bilan ikkita qoldiqni ajratuvchi aminokislotalar soni) va mutatsiyalarga chidamlilik o'rtasidagi bog'liqlik, ketma-ketlik o'xshashligi bilan juftlik taqqoslashlari yordamida 10- 20%.

A) Barcha qoldiqlar B) Kontaktlar soni kam bo'lgan spiral qoldiqlari va ko'p miqdordagi kontaktli ip qoldiqlari (3-rasmga qarang). Yulduzlar iplar va spirallar o'rtasidagi sezilarli farqni ko'rsatadi (proportsional testlar, p < 0,05, Holm-Bonferroni usuli bilan bir nechta taqqoslash uchun tuzatilgan).

S8 Shakl. RSA aminokislotalarning o'zgarishini qoldiqlarning kontakt zichligidan (CD) yaxshiroq bashorat qiladi.

Grafikda RSA va CD ahamiyatining scatter grafigi ko'rsatilgan, ikki o'lchovli biriktirilgandan keyin. Biz 45-55% gacha bo'lgan ketma-ketlik o'xshashligi bilan SCOP domenlarining barcha juft tuzilmalarini tanladik (1-rasmga qarang). Har bir juft hizalanish uchun har bir qoldiq uchun RSA va CD aniqlandi va aminokislota o'zgarishi, RSA va CD o'rtasidagi munosabatni aniqlash uchun logistik regressiya qilindi. Aminokislota o'zgarishi ikkilik o'zgaruvchi sifatida ko'rib chiqildi: tekislangan qoldiqlar bir xil bo'lsa, pozitsiya 0, agar bo'lmasa, 1 deb belgilandi. Ikki bashorat qiluvchining nisbiy ahamiyatini olish uchun "karet" R paketining "varImp" funktsiyasidan foydalanildi. har bir regressiya uchun (0-100 shkalasida), ular keyinchalik chizilgan va aniqlik uchun "hexbin" R paketi bilan 2D formatda biriktirilgan. Ushbu yondashuv asosiy bo'lsa-da va aminokislotalar o'zgarishining aniq sur'atlarini aniqlash uchun mos bo'lmasa-da, ikkita bashorat qiluvchining ahamiyatini sifatli taqqoslash uchun etarli. Umuman olganda, RSA ham, CD ham aminokislota o'zgarishi yoki o'zgarmasligini nisbatan yomon bashorat qiladi, shunga qaramay, RSA doimiy ravishda CD dan ustundir.

S9-rasm. Ikkilamchi tuzilmani buzadigan nuqta mutatsiyalari ko'pincha ikkilamchi struktura birliklarining uchlariga yaqin joylashgan.

S10-rasm. Missense mutatsiyalari iplar yoki bobinlarga qaraganda spirallarni kamroq buzadi.

(* Holm-Bonferroni usuli bilan bir nechta sinov uchun tuzatilgan spiral va iplar o'rtasidagi sezilarli farqni ko'rsatadi. (p < 0,05, nisbatlar testlari)

S11-rasm. Ikkilamchi tuzilmani o'zgartirish PolyPhen-2 patogenligini bashorat qilishni yaxshilash uchun ishlatilishi mumkin, hatto yovvoyi tur uchun tizimli ma'lumot mavjud bo'lmasa ham, faqat taxmin qilingan ma'lumotlar.

Shakl sifat jihatidan 5C-rasmga o'xshaydi, ammo patogen mutantlarning chastotalari pastroq, chunki PDB patogen noto'g'ri mutatsiyaga ega bo'lgan oqsillarga moyil: eksperimental ravishda aniqlangan tuzilishga solishtirilishi mumkin bo'lgan inson patogen mutatsiyalarining 50%, lekin faqat 10%. neytral mutatsiyalar. (Xato satrlari 95% ishonch oralig'ini ifodalaydi, "*" 0,05 dan past ahamiyatga ega va "**" 0,005 dan past ahamiyatga ega (proporsiya testlari), Benjamini-Xochberg usuli bilan noto'g'ri aniqlash tezligi uchun nazorat qilinadi).

S12-rasm Mutatsiyalarning turli ikkilamchi tuzilmalar ichida buklanishning erkin energiyasiga (ddG) ta'siri.

Yulduzlar jiddiy farqni ko'rsatadi (*: p < 0,05 **: p < 0,005), noto'g'ri kashfiyot tezligini tuzatishdan so'ng (Benjamini-Xochberg usuli bilan). Mutatsiyalarning aksariyati ikkilamchi strukturaning o'zgarishiga olib kelmagani uchun, ikkilamchi tuzilma ddG ga ozgina ta'sir qiladi, shunga qaramay, halqalardagi mutatsiyalar iplar yoki spirallardagi mutatsiyalarga qaraganda doimiy ravishda ko'proq beqarorlik qiladi, hal qiluvchi ta'sir ko'rsatmaydigan eng ko'p ko'milgan qoldiqlar bundan mustasno. .

S13-rasm. RCSB oqsillarni taqqoslash vositasidan (CE algoritmi) juft-juft strukturaviy hizalanishlarni amalga oshirish uchun TMalign-dan foydalanganda bir xil naqsh paydo bo'ladi - spirallar ketma-ketlik o'zgarishi bilan kamroq o'zgaradi.

Panellar 2-rasmdagi D-F panellari bilan bir xil, ammo RCSB oqsillarni taqqoslash vositasidan foydalangan holda: ketma-ketlik o'xshashligi 10-20% bo'lgan hizalamalar, kovariat sifatida nisbiy erituvchiga kirish imkoniyati (RSA) bilan.


Protein ikkilamchi tuzilmalarida spirallarning har xil turlari qanday va ular qanday farqlanadi? - Biologiya

Aminokislotalar, polipeptidlar va moslashuvchan zanjirlar

Har bir aminokislotaning yon zanjiri (yoki R-guruhi) mavjud bo'lib, ular nazariy jihatdan juda ko'p turli xil kimyoviy shakllarni olishlari mumkin, ammo bu shakllarning faqat 20-22 tasi umumiy oqsillarda uchraydi.

Shaxsiy kimyoviy farqlarga qaramay, aminokislotalar (va ularning R-guruhlari) ularning R-guruhlari mavjudligiga qarab to'rt xil "oila" ga bo'linishi mumkin:

Taxminan 5 ta aminokislotalar kislotali yoki asosli bo'lib, ularning R-guruhlari musbat yoki manfiy zaryadga ega bo'lgan kimyoviy tuzilish hosil qilish uchun turli pHlarda ionlanadi. Ushbu turdagi R -guruhlari kuchli gidrofil bo'lib, suv bilan o'ralgan holda barqarorlashadi.

Suv bilan aloqa qilganda barqaror bo'lmagan R -guruhlarga ega bo'lgan 10 ga yaqin qutbsiz aminokislotalar mavjud. Ular hidrofobikdir.

Taxminan 5 ta aminokislota qutbli yon zanjirlarga ega, R-guruhlari ionlanmaydi yoki musbat yoki manfiy zaryadlanmaydi. Bu R-guruhlar kuchli hidrofil ham, hidrofobik ham emas.

Polipeptidlar kabi uzun molekulalardagi atomlar kosmosda yoki holatda qattiq mahkamlanmagan. Ularni birlashtirgan kovalent bog'lanishlar atomlarning aylanishiga va ular eng barqaror bo'lgan molekulada uch o'lchovli pozitsiyani egallashiga imkon beradi. Bu "bog' atrofida aylanish" xususiyati polipeptidlar va oqsillarning boshqa barcha xususiyatlari uchun muhim oqibatlarga olib keladi.

Polipeptidning peptid bog'lari bilan bog'langan orqa suyagi egiluvchan bo'lgani uchun ("barcha bu bog'lanishlar atrofida aylanish" tufayli), zanjir egilishi, burishishi va juda katta xilma-xil uch o'lchamli shakllarga ega bo'lishi mumkin. Suvda bo'lganida, ko'pchilik polipeptidlar o'z-o'zidan o'zlarini barqaror va biologik roli uchun muhim bo'lgan shaklga aylantiradilar.

Proteinlar juda katta molekulalar bo'lib, ular qo'llab-quvvatlanmasa, hujayraning tubiga tushish uchun etarlicha og'irdir. Suvda polipeptid hosil bo'lganida, agar u bir vaqtning o'zida tortishish kuchi bilan hujayraning tubiga tortilsa va u erda qolsa, u hech qanday biologik rol o'ynay olmaydi!

Biroq, polipeptid moslashuvchan zanjir bo'lganligi sababli, u deyarli har qanday shaklda egilib, burishishi mumkin. Bu shakl tasodifiy emas, balki ichki R -guruhlar, peptid bog'lari va tashqi suvli muhit o'rtasidagi turli xil molekulalararo va ichki kuchlar seriyasining natijasidir.

Bu kuchlarning eng muhimlaridan biri gidrofil kislotali va asosli R -guruhlarning va uning atrofidagi suvlarning ta'siri va o'zaro ta'siridir. Suvli muhitda polipeptid gidrofil R-guruhlarining maksimal soni barqaror bo'lgan suvga tarqalguncha egilib, buriladi.

Bu polipeptid/oqsil makromolekulasiga ikkita ta'sir ko'rsatadi, u butun molekulaga xarakterli shakl berishni boshlaydi, shuningdek, qo'llab-quvvatlash vositasini ta'minlaydi. Polipeptid/oqsil yuzasidan chiqib turgan gidrofil R-guruhlari suv molekulalari bilan o'zaro ta'sir qiladi va ulkan makromolekulani suspenziyada ushlab turadi. Shunday qilib, oqsil hujayraning tubiga "cho'kmaydi".

Polipeptid zanjiridan chiqib ketadigan ko'pgina R-guruhlari hidrofobik yoki hech bo'lmaganda gidrofil bo'lmagan. Ushbu yon zanjirlar suv bilan o'ralgan bo'lsa, oqsil molekulasini beqarorlashtiradi va uni suvda juda erimaydigan qiladi.

Yaxshiyamki, polipeptid molekulalari bu sodir bo'lishiga to'sqinlik qiladigan tarzda o'zlarini qayta shakllantirishlari mumkin. Hidrofobik R-guruhlarning ko'pchiligi yoki ko'pchiligi oxir-oqibat molekulaning o'rtasiga to'g'ri keladi, bu atrofdagi suvdan eng uzoqda joylashgan nuqtadir. Bunda ular suvni kuchli qaytaruvchi zona yoki muhit yaratadilar.

Lipid yoki uglevodorod molekulalari suvga solinganda birikib yog 'yoki moy tomchisini hosil qilganidek, hidrofobik R-guruhlari ham xuddi shunday ta'sir ko'rsatadi, suv deyarli bir xil ta'sir qiladi va butun tuzilish barqarorlashadi.

Shuning uchun ko'plab globulyar oqsillar o'zlarining hidrofobik R-guruhlari yadrolarida chuqur ko'milgan bo'lib, yakuniy oqsil molekulasining umumiy uch o'lchovli tuzilishini saqlashda muhim rol o'ynaydigan suvdan tashqari hududni yaratadilar.

Polipeptid molekulasining o'zida turli xil kuchlar to'plami ishlaydi. Molekulyar ichidagi kuchlar aminokislotalar zanjiri segmentlarining qismlarini tortadi yoki qaytaradi, chunki turli R-guruhlar bir-biriga yaqinlashadi.

Ushbu molekula ichidagi kuchlarning eng kuchlisi, to'g'ri sharoitda, ikkita sistein aminokislotalarining ikkita R-guruhi o'rtasida hosil bo'ladigan kovalent bog'lanishdir.

Hujayralardan ajralib chiqadigan yoki hujayralar yuzasida joylashgan ko'plab oqsillar ikkita oltingugurt o'z ichiga olgan aminokislotalar R -guruhlari o'rtasida hosil bo'lgan o'zaro bog'lanishlar orqali uzunligi bo'ylab joylarda "nuqta payvandlanadi". Disulfid ko'priklar (shuningdek, "disulfid bog'lari" yoki "-S-S-bog'lar" deb ataladi) kuchli barqarorlashadi, ayniqsa oqsil hujayradan tashqariga o'tkazilishi kerak bo'lsa.

Ushbu turdagi o'zaro bog'lanishlar uch o'lchovli oqsil shaklini yaratish uchun muhim emas, balki ularni hosil bo'lgandan keyin to'g'ri shaklda ushlab turish uchun ishlatiladi.

Kimyoviy qaytaruvchi moddalar oqsilning umumiy shaklini moddiy jihatdan o'zgartirmasdan, bu o'zaro bog'lanishlarni sindirish, ularni ochish uchun ishlatilishi mumkin.

Katlanadigan naqshlar
Beta qatlamli varaq

Kovalent -S-S- bog'lanish kabi kuchli bo'lmasa-da, turli R-guruhlar bir xil polipeptid zanjirining ikkita uzunligi bo'ylab bir-biri bilan yaqin aloqada bo'lishi mumkin va bo'ladi. Ijobiy zaryadlangan R-guruh zanjirning boshqa pozitsiyasida manfiy zaryadlangan R-guruhga tortiladi va butun molekula ularning yaqin assotsiatsiyasi bilan bir oz ko'proq barqarorlashadi.

Shu bilan birga, peptid bog'ining o'zi ichidagi atom tuzilishi boshqa bir qator mumkin bo'lgan tortishishlarni keltirib chiqaradi va shu bilan polipeptid ichidagi kuchlarni birlashtiradi.

C=O karboksil guruhidagi kislorod atomi bir oz manfiy zaryadga ega (kislorod atomining yuqori elektromanfiyligi tufayli), peptid bog'ining amin guruhidagi ( =N-H ) vodorod atomi esa kichik musbat zaryadga ega.

Ikki xil peptid aloqalari o'rtasida vodorod bog'i deb ataladigan tortishish kuchi paydo bo'lishi odatiy va osondir. Vodorod aloqalari juda zaif tortishish kuchlari bo'lsa-da, agar ular etarli bo'lsa, kattaroq shakllantiruvchi kuchlar paydo bo'lishi mumkin.

Ulardan biri ikki uzunlikdagi polipeptid bir-biriga qarama-qarshi yo'nalishda (antiparallel) harakat qilganda paydo bo'ladigan beta-pleated varaq (yoki beta-varaq). Antikor molekulalaridan birida va ko'plab globulyar oqsillarda shunday holat mavjud.

Polipeptid uzunligi bir necha marta o'z-o'zidan buklanib, "sendvich" tartibini hosil qiladi. Zanjirning bu uzunliklari bir-biriga qarama-qarshi uzunlikdagi peptid bog'lari o'rtasida hosil bo'lgan vodorod bog'lari orqali ushlab turiladi. Ushbu antiparallel beta-varaq kamdan-kam hollarda mukammal bo'ladi va ko'pincha bir oz burishadi va ideal shaklga qaraganda kamroq muntazamdir, chunki turli o'lchamdagi R -guruhlar molekulani buzishi mumkin va barcha peptid aloqalari vodorod bog'lanishining shakllanishida ishtirok etmaydi.

Bir xil uzunlikdagi polipeptid zanjiri bo'ylab peptid bog'lari o'rtasida vodorod bog'lari hosil bo'lganda, boshqa turdagi molekulyar struktura paydo bo'ladi.

Bu alfa-spiral, polipeptidning bahorga o'xshash bo'lagi bo'lib, u o'zini katta muntazamlikdagi qattiq silindrga aylantiradi. Ushbu turdagi strukturada aminokislotalar va zanjir bo'ylab bir to'rtta aminokislotalar o'rtasida vodorod aloqasi hosil bo'ladi.

Demak, mukammal alfa-spiralda har bir peptid bog'lanish zanjir uzunligidagi ikkita boshqa peptid bog'lari bilan vodorod bilan bog'langan, ammo bu tabiiy oqsillarda kamdan-kam uchraydi. Suv bilan o'ralgan holda, alfa-spiral odatda barqaror emas, lekin ko'plab transmembran oqsillarida (plazma membranasining lipid ikki qavatidan o'tadiganlar) topiladi, bu erda hidrofobik muhit aminokislotalar tsilindrini barqarorlashtirishga yordam beradi.

Katlama xom polipeptid zanjirining xususiyatlarini o'zgartiradi, uni hujayra va tirik organizm ichida biologik rol o'ynaydigan uch o'lchovli shaklga aylantiradi. To'liq yig'ilganda, oqsillar ajoyib xususiyatlar va funktsiyalarning ajoyib ko'p qirraliligini namoyish etadi.

Polipeptidning boshqa barcha xususiyatlarini aniqlaydigan xususiyati uning uzunligi bo'ylab aminokislotalarning ketma-ketligidir. Bu genetik kodni talqin qilish natijasida hosil bo'lgan oqsilning asosiy tuzilishi. Biroq, polipeptid zanjirining birlamchi tuzilishida yakuniy oqsilga uning biologik xususiyatlarini avtomatik ravishda beradigan hech narsa yo'q.

Vodorod aloqalari kabi molekula ichidagi kuchlar polipeptid zanjirining qismlarini alfa-spiral yoki beta-plastik varaq kabi muntazam, takrorlanuvchi tuzilmalarga birlashtirganda, zanjir qisqaradi. Uzunligi 300 ta aminokislotadan iborat polipeptid alfa-spiralga yig'ilganda bu uzunlikning yarmiga qisqaradi va beta qatlamli qatlamga yig'ilganda bu uzunlikning 10 foizidan kamiga qisqaradi. To'pga aylantirilganda, o'lcham yanada kichikroq bo'lishi mumkin. Bular oxirgi oqsilning ikkilamchi tuzilmalari bo'lib, ular oxirgi oqsil shaklini hosil qiladigan birinchi qatlamlanish darajasidir.

Biroq, butun bir oqsilning shakli ushbu ikkilamchi tuzilmalardan faqat bittasidan iborat bo'lishi kamdan-kam uchraydi. Ko'proq tarqalgani polipeptid uzunligining alfa-spiral mintaqasiga katlanması, undan keyin takroriy naqshsiz tasodifiy yurish mintaqasi, keyin alfa-spiralning boshqa mintaqasi va hokazo.

Globulyar oqsilda beta qatlamli qatlamning bitta asosiy hududi, alfa-spiralning bir nechta mintaqalari va N-terminus va C-terminal o'rtasida yana bir nechta tasodifiy yurish bo'lishi mumkin.

Ushbu hududlar yoki domenlar oqsil makromolekulasining yakuniy, umumiy uch o'lchovli tuzilishi ichidagi ikkilamchi strukturaning modullari sifatida ko'rib chiqilishi mumkin.

Ikkilamchi tuzilish sohalarini atrofdagi suv bilan yanada kattaroq o'zaro ta'sir kuchlari bilan birlashtirish (tashqi tomondan gidrofil, ichkarida hidrofobik) to'liq shakllangan, xarakterli, uch o'lchovli shakl yoki uchinchi darajali tuzilmani hosil qiladi, bu ko'pincha eng yuqori darajadir. ko'plab oqsillar tomonidan erishilgan tuzilish.

Aynan shu shakl darajasida oqsillar ko'pincha o'zlarining biologik xususiyatlarini namoyon qila boshlaydilar va o'zlarining belgilangan funktsiyalarini bajarishga qodir. Shakl bu biologik rol uchun juda muhimdir va agar oqsil boshqa shaklga majburlangan bo'lsa yoki bu shaklni yo'qotsa, oqsilning roli va xususiyatlari bir vaqtning o'zida yo'qoladi.

Shaklning bunday o'zgarishi va funksiyaning yo'qolishi denaturatsiya deb ataladi va denatüratsiyalangan oqsil odatda foydasiz bo'lib, shakl barcha oqsillarning muhim xususiyati ekanligi haqidagi fikrni mustahkamlaydi.

Tuzilishning to'rtinchi darajasi, to'rtlamchi tuzilish juda katta oqsillarda yoki juda murakkab oqsillarda uchraydi. Ular ko'pincha bir nechta katlanmış bo'linmalardan iborat (boshqa polipeptidlardan iborat) va ko'pincha lipidlar, uglevodlar, polinukleotidlar va hatto heterotsiklik halqalar kabi oqsil bo'lmagan qo'shimchalarga ega.

Tuzilish darajalarining bu ierarxiyasi, ehtimol, oqsilning ishlashiga aniq aloqasi yo'q, lekin to'liq ishlaydigan protein ishlab chiqarish uchun hujayra o'tishi kerak bo'lgan progressiyani ko'rsatishi mumkin.


Videoni tomosha qiling: Protein Powder and kidney disease: Whey, Rice, Pea, Essential, Amino Acids Protein Powder For CKD (Avgust 2022).