Ma `lumot

Nima uchun berilgan atlasdan katalitik sayt atlasida berilgan aminokislotalar ketma -ketligi RSCB oqsil ma'lumotlari bankidagi ketma -ketlikdan farq qiladi?

Nima uchun berilgan atlasdan katalitik sayt atlasida berilgan aminokislotalar ketma -ketligi RSCB oqsil ma'lumotlari bankidagi ketma -ketlikdan farq qiladi?



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Men ishlayotgan ushbu loyiha uchun fermentlarning amino kislotalar ketma -ketligini solishtirmoqchi edim va ularni katalitik saytida solishtirishim kerak edi. Buning uchun men katalitik saytdagi ma'lumotni olish uchun Katalitik sayt atlasiga bordim, lekin ular tuzilma ma'lumotlarini dasturiy ravishda yuklab olishning oson yo'lini taklif qilmagani uchun men fasta ketma-ketligini yuklab olish orqali uni RSCB PDB dan yuklab oldim. Katalitik saytlarni tekshirganda, bu CSA menga aytayotgan narsaga mos kelmadi va o'shanda ular turli xil fayllar ekanligini angladim. Masalan, 3nosni olaylik, CSA quyidagi ketma -ketlikni taqdim etadi:

MGNLKS…

PDB quyidagi ketma -ketlikni taqdim etadi:

PKFPRV…

Agar u bir xil protein bo'lsa, nima uchun ular bir xil ketma-ketlikda emas?

Kechirasiz, agar bu noob savol bo'lsa, men biolog emasman, shunchaki bioinformatikani yoqtiradigan kompyuter olimi.

Muhim ma'lumotlar:

CSA ma'lumotlari bu yerdan, PDB ma'lumotlari esa bu erdan keladi


Kristallografiya natijalari (pdb fayllari) deyarli har doim kesilgan ketma -ketlikni o'z ichiga oladi.

Proteinning har ikki uchi ham tez -tez egiluvchan bo'ladi (hatto kristalda ham) va yaxshi moslashish uchun etarli ma'lumotga ega bo'lmaydi. Tegishli qoldiqlar modeldan va ketma -ketlikdan olib tashlanadi va sizda faqat aniqlangan elektron zichligini ko'rsatadigan qoldiqlar qoladi.


Bir ketma-ketlik qisman ikkinchisida joylashgan (ta'kidlangan).

Shunday qilib, CSA ketma-ketligi (FASTA formati, kesilgan):

> sp | P29474 | NOS3_HUMAN Azot oksidi sintazasi, endoteliy OS = Homo sapiens GN = NOS3 PE = 1 SV = 3
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN

qulaylik uchun http://www.uniprot.org/uniprot/P29474 saytidan olingan.

PDB biri:

> 3NOS: A | PDBID | zanjir | KETLIGI PKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQA HEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLR SAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLL ...

Uniprot yozuvida muqobil biriktirish tufayli 3 xil izoform qayd etilgan, shuning uchun bu erda sodir bo'layotgan narsa. Mana ketma-ketlikni tekislashdan olingan natija (https://www.ebi.ac.uk/Tools/psa/emboss_matcher/ dan foydalanib):

#======================================== # # Hizalangan_ketma-ketliklar: 2 # 1: NOS3_HUMAN # 2: SEQUENCE # Matritsa: EBLOSUM62 # Gap_penalty: 14 # Extend_penalty: 4 # # Uzunlik: 240 # Identity: 240/240 (100,0%) # O'xshashlik: 240/240 (100,0%) # Bo'shliqlar: 0/0. ) # Bal: 1294 # # #========================================= NOS3_HUMAN 66 PKFPRVKNWEVGSITYDTLSAQQDGPCTPRRCLGSLVFPRKLQGRPSP 115 ||||||||||||||||||||||||||||||||||||| | SEQUENCE 1 PKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSP 50 NOS3_HUMAN 116 GPPAPEQLLSQARDFINQYYSSKRSGSQAHEQRLQEVEAEVAATGTYQLI MUXTI MUXTI SAYTI MUHAM DAVLATI MUHAMMALI? |||||||| SEQUENCE 51 GPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQL 100 NOS3_HUMAN 166 RESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHI 215 ||||||||||||| |||||||| SEQUENCE 101 RESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHI 150 NOS3_HUMAN 216 KYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVDGIHIHI? MHI? SI MUHDI SINI SINI? |||||||| SEQUENCE 151 KYATNRGNLRSAITVFPQRCPGRGDFRIWNSQLVRYAGYRQQDGSVRGDP 200 NOS3_HUMAN 266 ANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLL 305 ||||||||||||||||||||||||| SEQUENCE 201 ANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPELFLL 240

Bu javob to'g'ri, men shunchaki qo'shimcha qilmoqchimanki, DBREF yozuvidagi PDB faylida to'g'ri tartib raqamlash saqlangan (buni matn muharririda PDBni ochish orqali ko'rishingiz mumkin):

DBREF 3NOS A 66 492 UNP P29474 NOS3_HUMAN 66 492

Oddiy ingliz tilida ushbu faylda keltirilgan ketma-ketlik (3NOSzanjirA) qoldiqlarga to'g'ri keladi66-492UniProt bilan bog'liqUNP) kirish (kirish:P29474).


Videoni tomosha qiling: Milliy va Zamonaviy liboslar modasi va fasonlar Fashion UZ 3- qism 2017 (Avgust 2022).